![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
MC01g0127 (gene) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGTGAGAGGAAGAAGATGAAGGTGAAGAAAGGATGGTTGGCAGTGGAAGTAGGGTTGCAAGAGGAGGAAGATGGAAGAATAGAACGTTTTGTGGTTCCAATTTCCTATTTGTACCACCCTCTTTTCAAGAAGCTTTTGGACAAGGCTCAAGAAGTCTATGGCTACCATGCCAATGGCCCGCTCCGGCTCCCATGCTCGGTCGACGACTTTCTCCAGCTCCGGTGGCGGATCAAGAAAGAATCCGACCAACACGATGGGCAAAATGATCGCCACCGCCACCGCCAGCACCACCACCACTACCACCTTCCATTGGCTTTGTCTTTCCAGTCTTGC ATGGGTGAGAGGAAGAAGATGAAGGTGAAGAAAGGATGGTTGGCAGTGGAAGTAGGGTTGCAAGAGGAGGAAGATGGAAGAATAGAACGTTTTGTGGTTCCAATTTCCTATTTGTACCACCCTCTTTTCAAGAAGCTTTTGGACAAGGCTCAAGAAGTCTATGGCTACCATGCCAATGGCCCGCTCCGGCTCCCATGCTCGGTCGACGACTTTCTCCAGCTCCGGTGGCGGATCAAGAAAGAATCCGACCAACACGATGGGCAAAATGATCGCCACCGCCACCGCCAGCACCACCACCACTACCACCTTCCATTGGCTTTGTCTTTCCAGTCTTGC ATGGGTGAGAGGAAGAAGATGAAGGTGAAGAAAGGATGGTTGGCAGTGGAAGTAGGGTTGCAAGAGGAGGAAGATGGAAGAATAGAACGTTTTGTGGTTCCAATTTCCTATTTGTACCACCCTCTTTTCAAGAAGCTTTTGGACAAGGCTCAAGAAGTCTATGGCTACCATGCCAATGGCCCGCTCCGGCTCCCATGCTCGGTCGACGACTTTCTCCAGCTCCGGTGGCGGATCAAGAAAGAATCCGACCAACACGATGGGCAAAATGATCGCCACCGCCACCGCCAGCACCACCACCACTACCACCTTCCATTGGCTTTGTCTTTCCAGTCTTGC MGERKKMKVKKGWLAVEVGLQEEEDGRIERFVVPISYLYHPLFKKLLDKAQEVYGYHANGPLRLPCSVDDFLQLRWRIKKESDQHDGQNDRHRHRQHHHHYHLPLALSFQSC Homology
BLAST of MC01g0127 vs. ExPASy Swiss-Prot
Match: Q9ZUZ3 (Auxin-responsive protein SAUR32 OS=Arabidopsis thaliana OX=3702 GN=SAUR32 PE=2 SV=1) HSP 1 Score: 74.3 bits (181), Expect = 9.6e-13 Identity = 39/99 (39.39%), Postives = 59/99 (59.60%), Query Frame = 0
BLAST of MC01g0127 vs. ExPASy Swiss-Prot
Match: P33083 (Auxin-induced protein 6B OS=Glycine max OX=3847 PE=2 SV=1) HSP 1 Score: 62.8 bits (151), Expect = 2.9e-09 Identity = 33/68 (48.53%), Postives = 45/68 (66.18%), Query Frame = 0
BLAST of MC01g0127 vs. ExPASy Swiss-Prot
Match: P33080 (Auxin-induced protein X10A OS=Glycine max OX=3847 PE=2 SV=1) HSP 1 Score: 60.5 bits (145), Expect = 1.4e-08 Identity = 30/69 (43.48%), Postives = 45/69 (65.22%), Query Frame = 0
BLAST of MC01g0127 vs. ExPASy Swiss-Prot
Match: P33079 (Auxin-induced protein 10A5 OS=Glycine max OX=3847 PE=2 SV=1) HSP 1 Score: 59.3 bits (142), Expect = 3.2e-08 Identity = 29/71 (40.85%), Postives = 45/71 (63.38%), Query Frame = 0
BLAST of MC01g0127 vs. ExPASy Swiss-Prot
Match: Q41220 (Auxin-responsive protein SAUR15 OS=Arabidopsis thaliana OX=3702 GN=SAUR15 PE=1 SV=1) HSP 1 Score: 58.9 bits (141), Expect = 4.2e-08 Identity = 31/77 (40.26%), Postives = 48/77 (62.34%), Query Frame = 0
BLAST of MC01g0127 vs. NCBI nr
Match: XP_022154927.1 (auxin-responsive protein SAUR32-like [Momordica charantia]) HSP 1 Score: 236 bits (603), Expect = 1.11e-78 Identity = 112/112 (100.00%), Postives = 112/112 (100.00%), Query Frame = 0
BLAST of MC01g0127 vs. NCBI nr
Match: KGN54862.1 (hypothetical protein Csa_012431 [Cucumis sativus]) HSP 1 Score: 197 bits (501), Expect = 4.17e-63 Identity = 99/114 (86.84%), Postives = 105/114 (92.11%), Query Frame = 0
BLAST of MC01g0127 vs. NCBI nr
Match: KAG6603263.1 (Auxin-responsive protein SAUR32, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 188 bits (478), Expect = 1.34e-59 Identity = 96/114 (84.21%), Postives = 105/114 (92.11%), Query Frame = 0
BLAST of MC01g0127 vs. NCBI nr
Match: KAG6603262.1 (Auxin-responsive protein SAUR32, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 185 bits (469), Expect = 3.16e-58 Identity = 94/114 (82.46%), Postives = 105/114 (92.11%), Query Frame = 0
BLAST of MC01g0127 vs. NCBI nr
Match: XP_002272614.1 (PREDICTED: auxin-responsive protein SAUR32-like [Vitis vinifera] >RVX21191.1 Auxin-responsive protein SAUR32 [Vitis vinifera]) HSP 1 Score: 162 bits (410), Expect = 2.28e-49 Identity = 80/112 (71.43%), Postives = 89/112 (79.46%), Query Frame = 0
BLAST of MC01g0127 vs. ExPASy TrEMBL
Match: A0A6J1DN07 (auxin-responsive protein SAUR32-like OS=Momordica charantia OX=3673 GN=LOC111022073 PE=3 SV=1) HSP 1 Score: 236 bits (603), Expect = 5.38e-79 Identity = 112/112 (100.00%), Postives = 112/112 (100.00%), Query Frame = 0
BLAST of MC01g0127 vs. ExPASy TrEMBL
Match: A0A0A0L2M8 (SAUR family protein OS=Cucumis sativus OX=3659 GN=Csa_4G556180 PE=3 SV=1) HSP 1 Score: 197 bits (501), Expect = 2.02e-63 Identity = 99/114 (86.84%), Postives = 105/114 (92.11%), Query Frame = 0
BLAST of MC01g0127 vs. ExPASy TrEMBL
Match: A0A438KIZ8 (Auxin-responsive protein SAUR32 OS=Vitis vinifera OX=29760 GN=SAUR32_2 PE=3 SV=1) HSP 1 Score: 162 bits (410), Expect = 1.11e-49 Identity = 80/112 (71.43%), Postives = 89/112 (79.46%), Query Frame = 0
BLAST of MC01g0127 vs. ExPASy TrEMBL
Match: A0A2N9INR0 (Uncharacterized protein OS=Fagus sylvatica OX=28930 GN=FSB_LOCUS53816 PE=3 SV=1) HSP 1 Score: 161 bits (407), Expect = 3.48e-49 Identity = 78/110 (70.91%), Postives = 88/110 (80.00%), Query Frame = 0
BLAST of MC01g0127 vs. ExPASy TrEMBL
Match: A0A7N2MR82 (Uncharacterized protein OS=Quercus lobata OX=97700 PE=3 SV=1) HSP 1 Score: 160 bits (405), Expect = 6.59e-49 Identity = 79/112 (70.54%), Postives = 89/112 (79.46%), Query Frame = 0
BLAST of MC01g0127 vs. TAIR 10
Match: AT4G00880.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 75.1 bits (183), Expect = 4.0e-14 Identity = 43/101 (42.57%), Postives = 61/101 (60.40%), Query Frame = 0
BLAST of MC01g0127 vs. TAIR 10
Match: AT5G53590.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 74.7 bits (182), Expect = 5.2e-14 Identity = 37/92 (40.22%), Postives = 60/92 (65.22%), Query Frame = 0
BLAST of MC01g0127 vs. TAIR 10
Match: AT2G46690.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 74.3 bits (181), Expect = 6.8e-14 Identity = 39/99 (39.39%), Postives = 59/99 (59.60%), Query Frame = 0
BLAST of MC01g0127 vs. TAIR 10
Match: AT3G61900.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 67.8 bits (164), Expect = 6.4e-12 Identity = 34/78 (43.59%), Postives = 49/78 (62.82%), Query Frame = 0
BLAST of MC01g0127 vs. TAIR 10
Match: AT4G34780.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 64.3 bits (155), Expect = 7.1e-11 Identity = 36/78 (46.15%), Postives = 50/78 (64.10%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|