MC01g0029 (gene) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGATTTTTAAATCTTTTATACTAGGTAATCTAGTATCCTTCTGCATGAAGATAATCAATTCAGTCGTTGTGGTCGGACTCTATTATGGATTTCTGACCACATTCTCCATAGGGCCCTCTTATCTCTTCCTTCTCCGAGCTCGGGTTATGGAAGAAGGAACCGAGAAGAAAGTATCAGCAACAACAGGTTTTATTACGGGACAACTCATGATG ATGATTTTTAAATCTTTTATACTAGGTAATCTAGTATCCTTCTGCATGAAGATAATCAATTCAGTCGTTGTGGTCGGACTCTATTATGGATTTCTGACCACATTCTCCATAGGGCCCTCTTATCTCTTCCTTCTCCGAGCTCGGGTTATGGAAGAAGGAACCGAGAAGAAAGTATCAGCAACAACAGGTTTTATTACGGGACAACTCATGATG ATGATTTTTAAATCTTTTATACTAGGTAATCTAGTATCCTTCTGCATGAAGATAATCAATTCAGTCGTTGTGGTCGGACTCTATTATGGATTTCTGACCACATTCTCCATAGGGCCCTCTTATCTCTTCCTTCTCCGAGCTCGGGTTATGGAAGAAGGAACCGAGAAGAAAGTATCAGCAACAACAGGTTTTATTACGGGACAACTCATGATG MIFKSFILGNLVSFCMKIINSVVVVGLYYGFLTTFSIGPSYLFLLRARVMEEGTEKKVSATTGFITGQLMM Homology
BLAST of MC01g0029 vs. ExPASy Swiss-Prot
Match: A0A393 (Protein TIC 214 OS=Coffea arabica OX=13443 GN=TIC214 PE=3 SV=1) HSP 1 Score: 132.9 bits (333), Expect = 1.4e-30 Identity = 68/71 (95.77%), Postives = 70/71 (98.59%), Query Frame = 0
BLAST of MC01g0029 vs. ExPASy Swiss-Prot
Match: A6MM95 (Protein TIC 214 OS=Buxus microphylla OX=153571 GN=TIC214 PE=3 SV=1) HSP 1 Score: 131.0 bits (328), Expect = 5.5e-30 Identity = 67/71 (94.37%), Postives = 69/71 (97.18%), Query Frame = 0
BLAST of MC01g0029 vs. ExPASy Swiss-Prot
Match: A6MMQ5 (Protein TIC 214 OS=Dioscorea elephantipes OX=145284 GN=TIC214 PE=3 SV=1) HSP 1 Score: 130.2 bits (326), Expect = 9.4e-30 Identity = 66/71 (92.96%), Postives = 70/71 (98.59%), Query Frame = 0
BLAST of MC01g0029 vs. ExPASy Swiss-Prot
Match: Q3C1P6 (Protein TIC 214 OS=Nicotiana sylvestris OX=4096 GN=TIC214 PE=3 SV=1) HSP 1 Score: 130.2 bits (326), Expect = 9.4e-30 Identity = 67/71 (94.37%), Postives = 69/71 (97.18%), Query Frame = 0
BLAST of MC01g0029 vs. ExPASy Swiss-Prot
Match: Q33BW4 (Protein TIC 214 OS=Nicotiana tomentosiformis OX=4098 GN=TIC214 PE=3 SV=1) HSP 1 Score: 130.2 bits (326), Expect = 9.4e-30 Identity = 67/71 (94.37%), Postives = 69/71 (97.18%), Query Frame = 0
BLAST of MC01g0029 vs. NCBI nr
Match: OWK25800.1 (hypothetical protein AJ87_01050 [Rhizobium yanglingense]) HSP 1 Score: 134 bits (336), Expect = 1.40e-38 Identity = 70/71 (98.59%), Postives = 70/71 (98.59%), Query Frame = 0
BLAST of MC01g0029 vs. NCBI nr
Match: AEK71575.1 (hypothetical chloroplast RF1, partial [Spiraea tomentosa]) HSP 1 Score: 134 bits (336), Expect = 4.89e-37 Identity = 70/71 (98.59%), Postives = 70/71 (98.59%), Query Frame = 0
BLAST of MC01g0029 vs. NCBI nr
Match: WP_131796261.1 (hypothetical protein, partial [Candidatus Frankia datiscae]) HSP 1 Score: 133 bits (335), Expect = 5.20e-37 Identity = 69/71 (97.18%), Postives = 70/71 (98.59%), Query Frame = 0
BLAST of MC01g0029 vs. NCBI nr
Match: YP_009706462.1 (Ycf1 [Styphnolobium japonicum var. japonicum] >AYM32459.1 Ycf1 [Styphnolobium japonicum var. japonicum]) HSP 1 Score: 129 bits (324), Expect = 8.61e-37 Identity = 67/71 (94.37%), Postives = 69/71 (97.18%), Query Frame = 0
BLAST of MC01g0029 vs. NCBI nr
Match: GFP97092.1 (protein tic 214 [Phtheirospermum japonicum]) HSP 1 Score: 128 bits (322), Expect = 1.84e-36 Identity = 66/71 (92.96%), Postives = 70/71 (98.59%), Query Frame = 0
BLAST of MC01g0029 vs. ExPASy TrEMBL
Match: A0A245ZAB5 (Uncharacterized protein OS=Rhizobium yanglingense OX=61013 GN=AJ87_01050 PE=4 SV=1) HSP 1 Score: 134 bits (336), Expect = 6.77e-39 Identity = 70/71 (98.59%), Postives = 70/71 (98.59%), Query Frame = 0
BLAST of MC01g0029 vs. ExPASy TrEMBL
Match: G0YD98 (Hypothetical chloroplast RF1 (Fragment) OS=Spiraea tomentosa OX=473049 GN=ycf1 PE=4 SV=1) HSP 1 Score: 134 bits (336), Expect = 2.37e-37 Identity = 70/71 (98.59%), Postives = 70/71 (98.59%), Query Frame = 0
BLAST of MC01g0029 vs. ExPASy TrEMBL
Match: A0A5K6W7Y8 (Protein TIC 214 OS=Styphnolobium japonicum var. japonicum OX=2479786 GN=ycf1 PE=3 SV=1) HSP 1 Score: 129 bits (324), Expect = 4.17e-37 Identity = 67/71 (94.37%), Postives = 69/71 (97.18%), Query Frame = 0
BLAST of MC01g0029 vs. ExPASy TrEMBL
Match: V9ZBS9 (Protein TIC 214 (Fragment) OS=Hamamelis mollis OX=4396 GN=ycf1 PE=3 SV=1) HSP 1 Score: 131 bits (330), Expect = 1.04e-36 Identity = 68/71 (95.77%), Postives = 70/71 (98.59%), Query Frame = 0
BLAST of MC01g0029 vs. ExPASy TrEMBL
Match: A0A6G9L6S8 (Protein TIC 214 OS=Gleditsia sinensis OX=66096 GN=ycf1 PE=3 SV=1) HSP 1 Score: 129 bits (324), Expect = 1.11e-36 Identity = 68/71 (95.77%), Postives = 68/71 (95.77%), Query Frame = 0
BLAST of MC01g0029 vs. TAIR 10
Match: ATCG01130.1 (Ycf1 protein ) HSP 1 Score: 125.9 bits (315), Expect = 1.3e-29 Identity = 67/74 (90.54%), Postives = 69/74 (93.24%), Query Frame = 0
BLAST of MC01g0029 vs. TAIR 10
Match: ATCG01000.1 (Ycf1 protein ) HSP 1 Score: 125.9 bits (315), Expect = 1.3e-29 Identity = 67/74 (90.54%), Postives = 69/74 (93.24%), Query Frame = 0
BLAST of MC01g0029 vs. TAIR 10
Match: ATMG00370.1 (Ycf1 protein ) HSP 1 Score: 123.6 bits (309), Expect = 6.2e-29 Identity = 66/74 (89.19%), Postives = 68/74 (91.89%), Query Frame = 0
BLAST of MC01g0029 vs. TAIR 10
Match: AT2G07739.1 (Ycf1 protein ) HSP 1 Score: 121.3 bits (303), Expect = 3.1e-28 Identity = 65/74 (87.84%), Postives = 67/74 (90.54%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|