MC00g0352 (gene) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.TTAGGTCTTTATTGGACCACGGGGAGTTTTGAATTTTGCGATTTGTTTAAAATATTCCATAACTTGATTTATAATAATGAGGTTAATTTCTTATTTGTTACTTTGTCTGCGGTCCTATTATTTGCAGGTGCAGTTGCT TTAGGTCTTTATTGGACCACGGGGAGTTTTGAATTTTGCGATTTGTTTAAAATATTCCATAACTTGATTTATAATAATGAGGTTAATTTCTTATTTGTTACTTTGTCTGCGGTCCTATTATTTGCAGGTGCAGTTGCT TTAGGTCTTTATTGGACCACGGGGAGTTTTGAATTTTGCGATTTGTTTAAAATATTCCATAACTTGATTTATAATAATGAGGTTAATTTCTTATTTGTTACTTTGTCTGCGGTCCTATTATTTGCAGGTGCAGTTGCT LGLYWTTGSFEFCDLFKIFHNLIYNNEVNFLFVTLSAVLLFAGAVA Homology
BLAST of MC00g0352 vs. ExPASy Swiss-Prot
Match: Q68RV9 (NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic OS=Panax ginseng OX=4054 GN=ndhF PE=3 SV=1) HSP 1 Score: 80.5 bits (197), Expect = 5.5e-15 Identity = 41/46 (89.13%), Postives = 41/46 (89.13%), Query Frame = 0
BLAST of MC00g0352 vs. ExPASy Swiss-Prot
Match: B1NWJ6 (NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic OS=Manihot esculenta OX=3983 GN=ndhF PE=3 SV=1) HSP 1 Score: 80.1 bits (196), Expect = 7.2e-15 Identity = 39/46 (84.78%), Postives = 43/46 (93.48%), Query Frame = 0
BLAST of MC00g0352 vs. ExPASy Swiss-Prot
Match: Q2VED3 (NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic OS=Solanum tuberosum OX=4113 GN=ndhF PE=3 SV=1) HSP 1 Score: 79.7 bits (195), Expect = 9.4e-15 Identity = 40/46 (86.96%), Postives = 42/46 (91.30%), Query Frame = 0
BLAST of MC00g0352 vs. ExPASy Swiss-Prot
Match: Q2QD43 (NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic OS=Cucumis sativus OX=3659 GN=ndhF PE=3 SV=1) HSP 1 Score: 78.6 bits (192), Expect = 2.1e-14 Identity = 40/46 (86.96%), Postives = 43/46 (93.48%), Query Frame = 0
BLAST of MC00g0352 vs. ExPASy Swiss-Prot
Match: Q2MIE0 (NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic OS=Solanum bulbocastanum OX=147425 GN=ndhF PE=3 SV=1) HSP 1 Score: 78.6 bits (192), Expect = 2.1e-14 Identity = 39/46 (84.78%), Postives = 42/46 (91.30%), Query Frame = 0
BLAST of MC00g0352 vs. NCBI nr
Match: QHR81848.1 (NADH dehydrogenase subunit F, partial [Packera cymbalaria] >QHR81857.1 NADH dehydrogenase subunit F, partial [Packera werneriifolia]) HSP 1 Score: 79.7 bits (195), Expect = 5.67e-18 Identity = 38/46 (82.61%), Postives = 42/46 (91.30%), Query Frame = 0
BLAST of MC00g0352 vs. NCBI nr
Match: YP_009738250.1 (NADH dehydrogenase subunit 5 [Siraitia siamensis] >QIB71643.1 NADH dehydrogenase subunit 5 [Siraitia siamensis]) HSP 1 Score: 84.0 bits (206), Expect = 2.97e-17 Identity = 43/46 (93.48%), Postives = 44/46 (95.65%), Query Frame = 0
BLAST of MC00g0352 vs. NCBI nr
Match: CAM59971.2 (NADH dehydrogenase subunit F, partial [Hedera helix]) HSP 1 Score: 79.3 bits (194), Expect = 5.44e-17 Identity = 41/46 (89.13%), Postives = 41/46 (89.13%), Query Frame = 0
BLAST of MC00g0352 vs. NCBI nr
Match: QHR81692.1 (NADH dehydrogenase subunit F, partial [Drymocallis glandulosa]) HSP 1 Score: 77.0 bits (188), Expect = 6.60e-17 Identity = 39/46 (84.78%), Postives = 41/46 (89.13%), Query Frame = 0
BLAST of MC00g0352 vs. NCBI nr
Match: ABV65185.1 (NADH-plastoquinone oxidoreductase subunit 5, partial [Connarus conchocarpus]) HSP 1 Score: 80.5 bits (197), Expect = 7.99e-17 Identity = 41/46 (89.13%), Postives = 43/46 (93.48%), Query Frame = 0
BLAST of MC00g0352 vs. ExPASy TrEMBL
Match: A0A6C0UCC8 (NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic OS=Siraitia siamensis OX=2695833 GN=ndhF PE=3 SV=1) HSP 1 Score: 84.0 bits (206), Expect = 1.44e-17 Identity = 43/46 (93.48%), Postives = 44/46 (95.65%), Query Frame = 0
BLAST of MC00g0352 vs. ExPASy TrEMBL
Match: A7WN41 (NADH dehydrogenase subunit F (Fragment) OS=Hedera helix OX=4052 GN=ndhF PE=4 SV=1) HSP 1 Score: 79.3 bits (194), Expect = 2.63e-17 Identity = 41/46 (89.13%), Postives = 41/46 (89.13%), Query Frame = 0
BLAST of MC00g0352 vs. ExPASy TrEMBL
Match: A9XUM5 (NADH-plastoquinone oxidoreductase subunit 5 (Fragment) OS=Connarus conchocarpus OX=32210 GN=ndhF PE=4 SV=1) HSP 1 Score: 80.5 bits (197), Expect = 3.87e-17 Identity = 41/46 (89.13%), Postives = 43/46 (93.48%), Query Frame = 0
BLAST of MC00g0352 vs. ExPASy TrEMBL
Match: A0A6H0ERW7 (NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic OS=Cyclanthera pedata OX=198836 GN=ndhF PE=3 SV=1) HSP 1 Score: 82.4 bits (202), Expect = 5.00e-17 Identity = 42/46 (91.30%), Postives = 43/46 (93.48%), Query Frame = 0
BLAST of MC00g0352 vs. ExPASy TrEMBL
Match: A8W7H5 (NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic (Fragment) OS=Sinosenecio homogyniphyllus OX=479925 GN=ndhF PE=3 SV=1) HSP 1 Score: 82.4 bits (202), Expect = 5.00e-17 Identity = 40/46 (86.96%), Postives = 43/46 (93.48%), Query Frame = 0
BLAST of MC00g0352 vs. TAIR 10
Match: ATCG01010.1 (NADH-Ubiquinone oxidoreductase (complex I), chain 5 protein ) HSP 1 Score: 67.0 bits (162), Expect = 4.5e-12 Identity = 33/46 (71.74%), Postives = 37/46 (80.43%), Query Frame = 0
The following BLAST results are available for this feature:
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|