MC00g0318 (gene) Bitter gourd (Dali-11) v1
|
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ACCATGATACTTTCTGTTTTGTCAAGCCCAGCTTTGGTCTCTGGTTTGATGGTTGTACGTGCTAAAAATCCGGTACATTCCATTTTGTTTCTCATCCCAGTCTTTACCATGATACTTTCTGTTTTGTCAAGCCCAGCTTTGGTCTCTGGTTTGATGGTTGTACGTGCTAAAAATCCGGTACATTCCATTTTGTTTCTCATCCCAGTCTTT ACCATGATACTTTCTGTTTTGTCAAGCCCAGCTTTGGTCTCTGGTTTGATGGTTGTACGTGCTAAAAATCCGGTACATTCCATTTTGTTTCTCATCCCAGTCTTT TMILSVLSSPALVSGLMVVRAKNPVHSILFLIPVF Homology
BLAST of MC00g0318 vs. ExPASy Swiss-Prot
Match: P60498 (NADH-ubiquinone oxidoreductase chain 6 OS=Brassica campestris OX=3711 GN=ND6 PE=2 SV=1) HSP 1 Score: 58.5 bits (140), Expect = 1.7e-08 Identity = 31/34 (91.18%), Postives = 32/34 (94.12%), Query Frame = 0
BLAST of MC00g0318 vs. ExPASy Swiss-Prot
Match: Q02500 (NADH-ubiquinone oxidoreductase chain 6 OS=Triticum aestivum OX=4565 GN=ND6 PE=3 SV=1) HSP 1 Score: 57.8 bits (138), Expect = 2.9e-08 Identity = 32/35 (91.43%), Postives = 33/35 (94.29%), Query Frame = 0
BLAST of MC00g0318 vs. ExPASy Swiss-Prot
Match: P93314 (Uncharacterized mitochondrial cytochrome b-like protein AtMg00590 OS=Arabidopsis thaliana OX=3702 GN=AtMg00590 PE=2 SV=1) HSP 1 Score: 55.8 bits (133), Expect = 1.1e-07 Identity = 30/35 (85.71%), Postives = 32/35 (91.43%), Query Frame = 0
BLAST of MC00g0318 vs. ExPASy Swiss-Prot
Match: P60497 (NADH-ubiquinone oxidoreductase chain 6 OS=Arabidopsis thaliana OX=3702 GN=ND6 PE=1 SV=1) HSP 1 Score: 53.5 bits (127), Expect = 5.5e-07 Identity = 30/34 (88.24%), Postives = 31/34 (91.18%), Query Frame = 0
BLAST of MC00g0318 vs. NCBI nr
Match: XP_016500820.1 (PREDICTED: NADH-ubiquinone oxidoreductase chain 6-like [Nicotiana tabacum]) HSP 1 Score: 63.9 bits (154), Expect = 8.13e-11 Identity = 34/35 (97.14%), Postives = 35/35 (100.00%), Query Frame = 0
BLAST of MC00g0318 vs. NCBI nr
Match: YP_009682070.1 (NADH dehydrogenase subunit 6 [Physochlaina orientalis] >QDQ38384.1 NADH dehydrogenase subunit 6 [Physochlaina orientalis]) HSP 1 Score: 62.0 bits (149), Expect = 3.46e-10 Identity = 33/34 (97.06%), Postives = 34/34 (100.00%), Query Frame = 0
BLAST of MC00g0318 vs. NCBI nr
Match: YP_009121978.1 (NADH dehydrogenase subunit 6 [Hyoscyamus niger] >AJK91385.1 NADH dehydrogenase subunit 6 [Hyoscyamus niger]) HSP 1 Score: 62.0 bits (149), Expect = 3.46e-10 Identity = 33/34 (97.06%), Postives = 34/34 (100.00%), Query Frame = 0
BLAST of MC00g0318 vs. NCBI nr
Match: YP_009919572.1 (NADH dehydrogenase subunit 6 [Solanum melongena] >YP_009919588.1 NADH dehydrogenase subunit 6 [Solanum melongena] >YP_009919609.1 NADH dehydrogenase subunit 6 [Solanum aethiopicum] >QMQ97653.1 NADH dehydrogenase subunit 6 [Solanum sisymbriifolium] >QMQ98075.1 NADH dehydrogenase subunit 6 [Solanum anguivi] >QMQ97367.1 NADH dehydrogenase subunit 6 [Solanum aethiopicum] >QMQ97423.1 NADH dehydrogenase subunit 6 [Solanum melongena] >QMQ97425.1 NADH dehydrogenase subunit 6 [Solanum melongena]) HSP 1 Score: 62.0 bits (149), Expect = 4.03e-10 Identity = 33/34 (97.06%), Postives = 34/34 (100.00%), Query Frame = 0
BLAST of MC00g0318 vs. NCBI nr
Match: QMQ97470.1 (NADH dehydrogenase subunit 6 [Solanum wrightii] >QMQ97844.1 NADH dehydrogenase subunit 6 [Solanum macrocarpon]) HSP 1 Score: 62.0 bits (149), Expect = 4.03e-10 Identity = 33/34 (97.06%), Postives = 34/34 (100.00%), Query Frame = 0
BLAST of MC00g0318 vs. ExPASy TrEMBL
Match: A0A1S4CHZ5 (NAD(P)H dehydrogenase subunit 6 OS=Nicotiana tabacum OX=4097 GN=LOC107819246 PE=3 SV=1) HSP 1 Score: 63.9 bits (154), Expect = 3.94e-11 Identity = 34/35 (97.14%), Postives = 35/35 (100.00%), Query Frame = 0
BLAST of MC00g0318 vs. ExPASy TrEMBL
Match: A0A0C5B2B6 (NADH-ubiquinone oxidoreductase chain 6 OS=Hyoscyamus niger OX=4079 GN=nad6 PE=3 SV=1) HSP 1 Score: 62.0 bits (149), Expect = 1.68e-10 Identity = 33/34 (97.06%), Postives = 34/34 (100.00%), Query Frame = 0
BLAST of MC00g0318 vs. ExPASy TrEMBL
Match: A0A516TB36 (NADH-ubiquinone oxidoreductase chain 6 OS=Physochlaina orientalis OX=451527 GN=nad6 PE=3 SV=1) HSP 1 Score: 62.0 bits (149), Expect = 1.68e-10 Identity = 33/34 (97.06%), Postives = 34/34 (100.00%), Query Frame = 0
BLAST of MC00g0318 vs. ExPASy TrEMBL
Match: A0A290WKX9 (NADH-ubiquinone oxidoreductase chain 6 OS=Solanum lycopersicum OX=4081 GN=nad6 PE=3 SV=1) HSP 1 Score: 62.0 bits (149), Expect = 1.95e-10 Identity = 33/34 (97.06%), Postives = 34/34 (100.00%), Query Frame = 0
BLAST of MC00g0318 vs. ExPASy TrEMBL
Match: A0A7S9DG11 (NADH dehydrogenase subunit 6 OS=Solanum stenotomum subsp. goniocalyx OX=1050191 GN=nad6 PE=4 SV=1) HSP 1 Score: 62.0 bits (149), Expect = 1.95e-10 Identity = 33/34 (97.06%), Postives = 34/34 (100.00%), Query Frame = 0
BLAST of MC00g0318 vs. TAIR 10
Match: ATMG00270.1 (NADH dehydrogenase 6 ) HSP 1 Score: 58.5 bits (140), Expect = 1.2e-09 Identity = 31/34 (91.18%), Postives = 32/34 (94.12%), Query Frame = 0
BLAST of MC00g0318 vs. TAIR 10
Match: AT2G07718.1 (Cytochrome b/b6 protein ) HSP 1 Score: 55.8 bits (133), Expect = 7.9e-09 Identity = 30/35 (85.71%), Postives = 32/35 (91.43%), Query Frame = 0
BLAST of MC00g0318 vs. TAIR 10
Match: ATMG00590.1 (Cytochrome b/b6 protein ) HSP 1 Score: 55.8 bits (133), Expect = 7.9e-09 Identity = 30/35 (85.71%), Postives = 32/35 (91.43%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|