
Lsi10G001290 (gene) Bottle gourd (USVL1VR-Ls) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAAACTAATCGGACGGAAAAGGAGAAGAGAGTTGACGGAATAGAGATAATTAATAATATGGCAGAATCAGGCGGCGGCAGAGGCGGAGTCAGGGCTTGCAACCAGAGCTGTGGTTGCGCAGTTCCCTGCCCCGGCGGCAACGCTTGTAGGTGCGCGACGGCCTCGGCACCGGCGCCGGCGGGAGGAGAGATGGCGCACGTGACATGCTCGTGCGGGGAGCACTGTGGGTGCAATCCCTGCACGTGTTCCAGCGCGGTGGTTGGAGTTGGGAAGGGTAACTGCAGGTGCGGCGAGAATTGTCGGTGTGAACCGTGCCGGTGTGAAACATGA ATGAAAACTAATCGGACGGAAAAGGAGAAGAGAGTTGACGGAATAGAGATAATTAATAATATGGCAGAATCAGGCGGCGGCAGAGGCGGAGTCAGGGCTTGCAACCAGAGCTGTGGTTGCGCAGTTCCCTGCCCCGGCGGCAACGCTTGTAGGTGCGCGACGGCCTCGGCACCGGCGCCGGCGGGAGGAGAGATGGCGCACGTGACATGCTCGTGCGGGGAGCACTGTGGGTGCAATCCCTGCACGTGTTCCAGCGCGGTGGTTGGAGTTGGGAAGGGTAACTGCAGGTGCGGCGAGAATTGTCGGTGTGAACCGTGCCGGTGTGAAACATGA ATGAAAACTAATCGGACGGAAAAGGAGAAGAGAGTTGACGGAATAGAGATAATTAATAATATGGCAGAATCAGGCGGCGGCAGAGGCGGAGTCAGGGCTTGCAACCAGAGCTGTGGTTGCGCAGTTCCCTGCCCCGGCGGCAACGCTTGTAGGTGCGCGACGGCCTCGGCACCGGCGCCGGCGGGAGGAGAGATGGCGCACGTGACATGCTCGTGCGGGGAGCACTGTGGGTGCAATCCCTGCACGTGTTCCAGCGCGGTGGTTGGAGTTGGGAAGGGTAACTGCAGGTGCGGCGAGAATTGTCGGTGTGAACCGTGCCGGTGTGAAACATGA MKTNRTEKEKRVDGIEIINNMAESGGGRGGVRACNQSCGCAVPCPGGNACRCATASAPAPAGGEMAHVTCSCGEHCGCNPCTCSSAVVGVGKGNCRCGENCRCEPCRCET Homology
BLAST of Lsi10G001290 vs. ExPASy Swiss-Prot
Match: P93746 (Metallothionein-like protein 4A OS=Arabidopsis thaliana OX=3702 GN=MT4A PE=2 SV=2) HSP 1 Score: 89.7 bits (221), Expect = 2.2e-17 Identity = 43/86 (50.00%), Postives = 48/86 (55.81%), Query Frame = 0
BLAST of Lsi10G001290 vs. ExPASy Swiss-Prot
Match: P30570 (EC protein III OS=Triticum aestivum OX=4565 PE=2 SV=2) HSP 1 Score: 85.5 bits (210), Expect = 4.1e-16 Identity = 42/81 (51.85%), Postives = 45/81 (55.56%), Query Frame = 0
BLAST of Lsi10G001290 vs. ExPASy Swiss-Prot
Match: P43401 (EC protein homolog OS=Zea mays OX=4577 PE=3 SV=2) HSP 1 Score: 85.5 bits (210), Expect = 4.1e-16 Identity = 39/77 (50.65%), Postives = 46/77 (59.74%), Query Frame = 0
BLAST of Lsi10G001290 vs. ExPASy Swiss-Prot
Match: Q42377 (Metallothionein-like protein 4B OS=Arabidopsis thaliana OX=3702 GN=MT4B PE=2 SV=2) HSP 1 Score: 85.1 bits (209), Expect = 5.4e-16 Identity = 41/86 (47.67%), Postives = 47/86 (54.65%), Query Frame = 0
BLAST of Lsi10G001290 vs. ExPASy Swiss-Prot
Match: P30569 (EC protein I/II OS=Triticum aestivum OX=4565 PE=1 SV=2) HSP 1 Score: 83.2 bits (204), Expect = 2.0e-15 Identity = 41/81 (50.62%), Postives = 45/81 (55.56%), Query Frame = 0
BLAST of Lsi10G001290 vs. ExPASy TrEMBL
Match: A0A6J1FWF6 (metallothionein-like protein 4A OS=Cucurbita moschata OX=3662 GN=LOC111448775 PE=4 SV=1) HSP 1 Score: 149.1 bits (375), Expect = 1.1e-32 Identity = 71/89 (79.78%), Postives = 78/89 (87.64%), Query Frame = 0
BLAST of Lsi10G001290 vs. ExPASy TrEMBL
Match: A0A6J1J5Z9 (metallothionein-like protein 4B OS=Cucurbita maxima OX=3661 GN=LOC111483762 PE=4 SV=1) HSP 1 Score: 147.1 bits (370), Expect = 4.2e-32 Identity = 70/89 (78.65%), Postives = 77/89 (86.52%), Query Frame = 0
BLAST of Lsi10G001290 vs. ExPASy TrEMBL
Match: A0A6J1CGB3 (metallothionein-like protein 4A OS=Momordica charantia OX=3673 GN=LOC111011270 PE=4 SV=1) HSP 1 Score: 138.3 bits (347), Expect = 2.0e-29 Identity = 67/88 (76.14%), Postives = 71/88 (80.68%), Query Frame = 0
BLAST of Lsi10G001290 vs. ExPASy TrEMBL
Match: A0A5D3CS48 (Metallothionein-like protein 4A OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold1275G00240 PE=4 SV=1) HSP 1 Score: 137.9 bits (346), Expect = 2.6e-29 Identity = 69/93 (74.19%), Postives = 75/93 (80.65%), Query Frame = 0
BLAST of Lsi10G001290 vs. ExPASy TrEMBL
Match: A0A1S3BJL5 (metallothionein-like protein 4A OS=Cucumis melo OX=3656 GN=LOC103490606 PE=4 SV=1) HSP 1 Score: 137.9 bits (346), Expect = 2.6e-29 Identity = 69/93 (74.19%), Postives = 75/93 (80.65%), Query Frame = 0
BLAST of Lsi10G001290 vs. NCBI nr
Match: XP_022944284.1 (metallothionein-like protein 4A [Cucurbita moschata] >KAG6570975.1 Metallothionein-like protein 4A, partial [Cucurbita argyrosperma subsp. sororia] >KAG7010813.1 Metallothionein-like protein 4A, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 149.1 bits (375), Expect = 2.3e-32 Identity = 71/89 (79.78%), Postives = 78/89 (87.64%), Query Frame = 0
BLAST of Lsi10G001290 vs. NCBI nr
Match: XP_023513130.1 (metallothionein-like protein 4A [Cucurbita pepo subsp. pepo]) HSP 1 Score: 147.1 bits (370), Expect = 8.7e-32 Identity = 70/90 (77.78%), Postives = 77/90 (85.56%), Query Frame = 0
BLAST of Lsi10G001290 vs. NCBI nr
Match: XP_022985832.1 (metallothionein-like protein 4B [Cucurbita maxima]) HSP 1 Score: 147.1 bits (370), Expect = 8.7e-32 Identity = 70/89 (78.65%), Postives = 77/89 (86.52%), Query Frame = 0
BLAST of Lsi10G001290 vs. NCBI nr
Match: XP_022140669.1 (metallothionein-like protein 4A [Momordica charantia]) HSP 1 Score: 138.3 bits (347), Expect = 4.1e-29 Identity = 67/88 (76.14%), Postives = 71/88 (80.68%), Query Frame = 0
BLAST of Lsi10G001290 vs. NCBI nr
Match: XP_008448405.1 (PREDICTED: metallothionein-like protein 4A [Cucumis melo] >TYK14631.1 metallothionein-like protein 4A [Cucumis melo var. makuwa]) HSP 1 Score: 137.9 bits (346), Expect = 5.3e-29 Identity = 69/93 (74.19%), Postives = 75/93 (80.65%), Query Frame = 0
BLAST of Lsi10G001290 vs. TAIR 10
Match: AT2G42000.1 (Plant EC metallothionein-like protein, family 15 ) HSP 1 Score: 90.5 bits (223), Expect = 9.1e-19 Identity = 43/92 (46.74%), Postives = 50/92 (54.35%), Query Frame = 0
BLAST of Lsi10G001290 vs. TAIR 10
Match: AT2G42000.2 (Plant EC metallothionein-like protein, family 15 ) HSP 1 Score: 90.5 bits (223), Expect = 9.1e-19 Identity = 43/92 (46.74%), Postives = 50/92 (54.35%), Query Frame = 0
BLAST of Lsi10G001290 vs. TAIR 10
Match: AT2G23240.1 (Plant EC metallothionein-like protein, family 15 ) HSP 1 Score: 85.1 bits (209), Expect = 3.8e-17 Identity = 41/86 (47.67%), Postives = 47/86 (54.65%), Query Frame = 0
BLAST of Lsi10G001290 vs. TAIR 10
Match: AT2G23240.2 (Plant EC metallothionein-like protein, family 15 ) HSP 1 Score: 82.8 bits (203), Expect = 1.9e-16 Identity = 40/86 (46.51%), Postives = 47/86 (54.65%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bottle gourd (USVL1VR-Ls) v1
Date Performed: 2021-10-18 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|