Lsi09G014030 (gene) Bottle gourd (USVL1VR-Ls) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGAAACGTGAAGCTCTGCCTATTTCTCCTCTTCATCGCCGTCGCCACCGCCCCTCTTGCCCTTGCCTTTCCCGACGACTGGGCCCGTGCTTACGGTGCACCCGATTACGCCTTTTGGGGCTCATCCACACCAACGACAGCGGTTGACGACAGCCGGCGGCTACTCTTCCAATATGGATTTGCTTACAAATACCCAAGAAACAGGTATTTGAGCTATGATGCACTTAGGAAGAACAATATCCCTTGCGGCCGCCGTGGTACCTCTTACTATGCCTGCGAGAAGCGCCGAAAGGCCAACCCTTACCGTCGTGGTTGCACCGCCATCACCGGCTGCGCTCGCTTCACAGATTAA ATGGGAAACGTGAAGCTCTGCCTATTTCTCCTCTTCATCGCCGTCGCCACCGCCCCTCTTGCCCTTGCCTTTCCCGACGACTGGGCCCGTGCTTACGGTGCACCCGATTACGCCTTTTGGGGCTCATCCACACCAACGACAGCGGTTGACGACAGCCGGCGGCTACTCTTCCAATATGGATTTGCTTACAAATACCCAAGAAACAGGTATTTGAGCTATGATGCACTTAGGAAGAACAATATCCCTTGCGGCCGCCGTGGTACCTCTTACTATGCCTGCGAGAAGCGCCGAAAGGCCAACCCTTACCGTCGTGGTTGCACCGCCATCACCGGCTGCGCTCGCTTCACAGATTAA ATGGGAAACGTGAAGCTCTGCCTATTTCTCCTCTTCATCGCCGTCGCCACCGCCCCTCTTGCCCTTGCCTTTCCCGACGACTGGGCCCGTGCTTACGGTGCACCCGATTACGCCTTTTGGGGCTCATCCACACCAACGACAGCGGTTGACGACAGCCGGCGGCTACTCTTCCAATATGGATTTGCTTACAAATACCCAAGAAACAGGTATTTGAGCTATGATGCACTTAGGAAGAACAATATCCCTTGCGGCCGCCGTGGTACCTCTTACTATGCCTGCGAGAAGCGCCGAAAGGCCAACCCTTACCGTCGTGGTTGCACCGCCATCACCGGCTGCGCTCGCTTCACAGATTAA MGNVKLCLFLLFIAVATAPLALAFPDDWARAYGAPDYAFWGSSTPTTAVDDSRRLLFQYGFAYKYPRNRYLSYDALRKNNIPCGRRGTSYYACEKRRKANPYRRGCTAITGCARFTD Homology
BLAST of Lsi09G014030 vs. ExPASy Swiss-Prot
Match: Q9FZA0 (Protein RALF-like 4 OS=Arabidopsis thaliana OX=3702 GN=RALFL4 PE=1 SV=1) HSP 1 Score: 80.5 bits (197), Expect = 1.4e-14 Identity = 33/47 (70.21%), Postives = 40/47 (85.11%), Query Frame = 0
BLAST of Lsi09G014030 vs. ExPASy Swiss-Prot
Match: Q6NME6 (Protein RALF-like 19 OS=Arabidopsis thaliana OX=3702 GN=RALFL19 PE=3 SV=1) HSP 1 Score: 79.0 bits (193), Expect = 4.1e-14 Identity = 34/50 (68.00%), Postives = 40/50 (80.00%), Query Frame = 0
BLAST of Lsi09G014030 vs. ExPASy Swiss-Prot
Match: Q9MA62 (Protein RALF-like 22 OS=Arabidopsis thaliana OX=3702 GN=RALFL22 PE=3 SV=1) HSP 1 Score: 70.1 bits (170), Expect = 1.9e-11 Identity = 32/65 (49.23%), Postives = 43/65 (66.15%), Query Frame = 0
BLAST of Lsi09G014030 vs. ExPASy Swiss-Prot
Match: Q9LUS7 (Rapid alkalinization factor 23 OS=Arabidopsis thaliana OX=3702 GN=RALF23 PE=1 SV=1) HSP 1 Score: 69.7 bits (169), Expect = 2.5e-11 Identity = 30/46 (65.22%), Postives = 35/46 (76.09%), Query Frame = 0
BLAST of Lsi09G014030 vs. ExPASy Swiss-Prot
Match: Q8L9P8 (Protein RALF-like 33 OS=Arabidopsis thaliana OX=3702 GN=RALFL33 PE=2 SV=1) HSP 1 Score: 68.2 bits (165), Expect = 7.2e-11 Identity = 28/46 (60.87%), Postives = 35/46 (76.09%), Query Frame = 0
BLAST of Lsi09G014030 vs. ExPASy TrEMBL
Match: A0A5A7SVY5 (Protein RALF-like 4 OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold111G001290 PE=3 SV=1) HSP 1 Score: 170.2 bits (430), Expect = 5.0e-39 Identity = 85/119 (71.43%), Postives = 93/119 (78.15%), Query Frame = 0
BLAST of Lsi09G014030 vs. ExPASy TrEMBL
Match: A0A1S4E1Z3 (protein RALF-like 4 OS=Cucumis melo OX=3656 GN=LOC107991607 PE=3 SV=1) HSP 1 Score: 170.2 bits (430), Expect = 5.0e-39 Identity = 85/119 (71.43%), Postives = 93/119 (78.15%), Query Frame = 0
BLAST of Lsi09G014030 vs. ExPASy TrEMBL
Match: A0A5D3DPV5 (Protein RALF-like 19 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold1230G00370 PE=3 SV=1) HSP 1 Score: 169.9 bits (429), Expect = 6.5e-39 Identity = 84/117 (71.79%), Postives = 91/117 (77.78%), Query Frame = 0
BLAST of Lsi09G014030 vs. ExPASy TrEMBL
Match: A0A0A0KCD7 (F3H9.8 protein OS=Cucumis sativus OX=3659 GN=Csa_6G199790 PE=3 SV=1) HSP 1 Score: 169.9 bits (429), Expect = 6.5e-39 Identity = 85/115 (73.91%), Postives = 91/115 (79.13%), Query Frame = 0
BLAST of Lsi09G014030 vs. ExPASy TrEMBL
Match: A0A1S3B2H7 (protein RALF-like 19 OS=Cucumis melo OX=3656 GN=LOC103485256 PE=3 SV=1) HSP 1 Score: 169.9 bits (429), Expect = 6.5e-39 Identity = 84/117 (71.79%), Postives = 91/117 (77.78%), Query Frame = 0
BLAST of Lsi09G014030 vs. NCBI nr
Match: XP_038876152.1 (uncharacterized protein LOC120068449 [Benincasa hispida]) HSP 1 Score: 192.6 bits (488), Expect = 1.9e-45 Identity = 88/117 (75.21%), Postives = 101/117 (86.32%), Query Frame = 0
BLAST of Lsi09G014030 vs. NCBI nr
Match: XP_016902249.1 (PREDICTED: protein RALF-like 4 [Cucumis melo] >KAA0033467.1 protein RALF-like 4 [Cucumis melo var. makuwa]) HSP 1 Score: 170.2 bits (430), Expect = 1.0e-38 Identity = 85/119 (71.43%), Postives = 93/119 (78.15%), Query Frame = 0
BLAST of Lsi09G014030 vs. NCBI nr
Match: XP_004150814.1 (protein RALF-like 4 [Cucumis sativus] >KGN47203.1 hypothetical protein Csa_020789 [Cucumis sativus]) HSP 1 Score: 169.9 bits (429), Expect = 1.3e-38 Identity = 85/115 (73.91%), Postives = 91/115 (79.13%), Query Frame = 0
BLAST of Lsi09G014030 vs. NCBI nr
Match: XP_008441015.1 (PREDICTED: protein RALF-like 19 [Cucumis melo] >KAA0025546.1 protein RALF-like 19 [Cucumis melo var. makuwa] >TYK25706.1 protein RALF-like 19 [Cucumis melo var. makuwa]) HSP 1 Score: 169.9 bits (429), Expect = 1.3e-38 Identity = 84/117 (71.79%), Postives = 91/117 (77.78%), Query Frame = 0
BLAST of Lsi09G014030 vs. NCBI nr
Match: XP_004148669.1 (protein RALF-like 19 [Cucumis sativus]) HSP 1 Score: 169.1 bits (427), Expect = 2.3e-38 Identity = 83/118 (70.34%), Postives = 91/118 (77.12%), Query Frame = 0
BLAST of Lsi09G014030 vs. TAIR 10
Match: AT1G28270.1 (ralf-like 4 ) HSP 1 Score: 80.5 bits (197), Expect = 1.0e-15 Identity = 33/47 (70.21%), Postives = 40/47 (85.11%), Query Frame = 0
BLAST of Lsi09G014030 vs. TAIR 10
Match: AT2G33775.1 (ralf-like 19 ) HSP 1 Score: 79.0 bits (193), Expect = 2.9e-15 Identity = 34/50 (68.00%), Postives = 40/50 (80.00%), Query Frame = 0
BLAST of Lsi09G014030 vs. TAIR 10
Match: AT3G05490.1 (ralf-like 22 ) HSP 1 Score: 70.1 bits (170), Expect = 1.3e-12 Identity = 32/65 (49.23%), Postives = 43/65 (66.15%), Query Frame = 0
BLAST of Lsi09G014030 vs. TAIR 10
Match: AT3G16570.1 (rapid alkalinization factor 23 ) HSP 1 Score: 69.7 bits (169), Expect = 1.8e-12 Identity = 30/46 (65.22%), Postives = 35/46 (76.09%), Query Frame = 0
BLAST of Lsi09G014030 vs. TAIR 10
Match: AT4G15800.1 (ralf-like 33 ) HSP 1 Score: 68.2 bits (165), Expect = 5.1e-12 Identity = 28/46 (60.87%), Postives = 35/46 (76.09%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bottle gourd (USVL1VR-Ls) v1
Date Performed: 2021-10-18
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|