Lsi08G016330 (gene) Bottle gourd (USVL1VR-Ls) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGTTGTCAATGACATCAAAGATCAAGGCTCATGTGGTATAATTTTGAATTTTGGTTGTGTAAAAGAGGTTGTTTGCAGGAAGTTGTTGGGCATTTGCAGACGTTGTTAAAATGAGTTGTCAATGACATCAAAGATCAAAATCCCTAGATGTTGTTAATTGTGATTTTAATGACGGAGGTTGCGAGGATTCTATAACTATGCTTTTAAATGCAAAATGATGGGATCACAACGGATAAAAACTATCCCTACTATGCCCAAAATGATTATTGCCGCCCATCGAGAGTGAGTGTGGAAGTAAATTAAACCCTAAATTAATATAAATGGAAGCTAATTAAATATATATTTTGATTTGACTAAGTGACAATTGTGGTGGTAGTTGGATACGGAATCGAGGAAGACGGAACAGATTATTGGATCATAAGTAACTCATGGAGAGTTGGATGGGAATTGGAAGGTTATATGAAGATGCAACGAGGAGTGGAGAATCCAGGAGGTGTATATGGATTGGCAATGAATTCTTCATATCCCGTAAAGCATAGCATCCACGCAGCTTCCTATTCTATTTCCATTCTTTTTAGCATTCTTTAG ATGATGACAATTGTGGTGGTAGTTGGATACGGAATCGAGGAAGACGGAACAGATTATTGGATCATAAGTAACTCATGGAGAGTTGGATGGGAATTGGAAGGTTATATGAAGATGCAACGAGGAGTGGAGAATCCAGGAGGTGTATATGGATTGGCAATGAATTCTTCATATCCCGTAAAGCATAGCATCCACGCAGCTTCCTATTCTATTTCCATTCTTTTTAGCATTCTTTAG ATGATGACAATTGTGGTGGTAGTTGGATACGGAATCGAGGAAGACGGAACAGATTATTGGATCATAAGTAACTCATGGAGAGTTGGATGGGAATTGGAAGGTTATATGAAGATGCAACGAGGAGTGGAGAATCCAGGAGGTGTATATGGATTGGCAATGAATTCTTCATATCCCGTAAAGCATAGCATCCACGCAGCTTCCTATTCTATTTCCATTCTTTTTAGCATTCTTTAG MMTIVVVVGYGIEEDGTDYWIISNSWRVGWELEGYMKMQRGVENPGGVYGLAMNSSYPVKHSIHAASYSISILFSIL Homology
BLAST of Lsi08G016330 vs. ExPASy Swiss-Prot
Match: Q9FGR9 (KDEL-tailed cysteine endopeptidase CEP1 OS=Arabidopsis thaliana OX=3702 GN=CEP1 PE=1 SV=1) HSP 1 Score: 73.2 bits (178), Expect = 1.5e-12 Identity = 31/58 (53.45%), Postives = 42/58 (72.41%), Query Frame = 0
BLAST of Lsi08G016330 vs. ExPASy Swiss-Prot
Match: P43156 (Thiol protease SEN102 OS=Hemerocallis sp. OX=29711 GN=SEN102 PE=2 SV=1) HSP 1 Score: 71.6 bits (174), Expect = 4.3e-12 Identity = 31/65 (47.69%), Postives = 42/65 (64.62%), Query Frame = 0
BLAST of Lsi08G016330 vs. ExPASy Swiss-Prot
Match: P12412 (Vignain OS=Vigna mungo OX=3915 PE=1 SV=1) HSP 1 Score: 71.2 bits (173), Expect = 5.6e-12 Identity = 31/67 (46.27%), Postives = 45/67 (67.16%), Query Frame = 0
BLAST of Lsi08G016330 vs. ExPASy Swiss-Prot
Match: Q9SUT0 (Probable cysteine protease RDL4 OS=Arabidopsis thaliana OX=3702 GN=RDL4 PE=2 SV=1) HSP 1 Score: 70.5 bits (171), Expect = 9.6e-12 Identity = 34/67 (50.75%), Postives = 45/67 (67.16%), Query Frame = 0
BLAST of Lsi08G016330 vs. ExPASy Swiss-Prot
Match: O65039 (Vignain OS=Ricinus communis OX=3988 GN=CYSEP PE=1 SV=1) HSP 1 Score: 69.7 bits (169), Expect = 1.6e-11 Identity = 28/58 (48.28%), Postives = 40/58 (68.97%), Query Frame = 0
BLAST of Lsi08G016330 vs. ExPASy TrEMBL
Match: A0A1S3BA70 (vignain-like OS=Cucumis melo OX=3656 GN=LOC103487731 PE=3 SV=1) HSP 1 Score: 86.3 bits (212), Expect = 6.2e-14 Identity = 35/56 (62.50%), Postives = 45/56 (80.36%), Query Frame = 0
BLAST of Lsi08G016330 vs. ExPASy TrEMBL
Match: A0A0A0LMU4 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_2G349680 PE=3 SV=1) HSP 1 Score: 83.2 bits (204), Expect = 5.3e-13 Identity = 33/57 (57.89%), Postives = 45/57 (78.95%), Query Frame = 0
BLAST of Lsi08G016330 vs. ExPASy TrEMBL
Match: Q84M27 (Cysteine protease-3 OS=Helianthus annuus OX=4232 GN=scp3 PE=2 SV=1) HSP 1 Score: 82.0 bits (201), Expect = 1.2e-12 Identity = 34/58 (58.62%), Postives = 45/58 (77.59%), Query Frame = 0
BLAST of Lsi08G016330 vs. ExPASy TrEMBL
Match: A0A6J1KIL0 (vignain-like OS=Cucurbita maxima OX=3661 GN=LOC111496079 PE=3 SV=1) HSP 1 Score: 81.6 bits (200), Expect = 1.5e-12 Identity = 33/56 (58.93%), Postives = 45/56 (80.36%), Query Frame = 0
BLAST of Lsi08G016330 vs. ExPASy TrEMBL
Match: A0A7C9DPJ4 (Phospholipase A(2) OS=Opuntia streptacantha OX=393608 PE=3 SV=1) HSP 1 Score: 81.6 bits (200), Expect = 1.5e-12 Identity = 36/60 (60.00%), Postives = 44/60 (73.33%), Query Frame = 0
BLAST of Lsi08G016330 vs. NCBI nr
Match: XP_038896226.1 (vignain-like [Benincasa hispida]) HSP 1 Score: 97.1 bits (240), Expect = 7.3e-17 Identity = 43/57 (75.44%), Postives = 46/57 (80.70%), Query Frame = 0
BLAST of Lsi08G016330 vs. NCBI nr
Match: XP_038885798.1 (vignain-like [Benincasa hispida]) HSP 1 Score: 91.7 bits (226), Expect = 3.1e-15 Identity = 41/57 (71.93%), Postives = 43/57 (75.44%), Query Frame = 0
BLAST of Lsi08G016330 vs. NCBI nr
Match: XP_038885064.1 (LOW QUALITY PROTEIN: vignain-like [Benincasa hispida]) HSP 1 Score: 87.4 bits (215), Expect = 5.8e-14 Identity = 36/56 (64.29%), Postives = 45/56 (80.36%), Query Frame = 0
BLAST of Lsi08G016330 vs. NCBI nr
Match: XP_008444390.1 (PREDICTED: vignain-like [Cucumis melo]) HSP 1 Score: 86.3 bits (212), Expect = 1.3e-13 Identity = 35/56 (62.50%), Postives = 45/56 (80.36%), Query Frame = 0
BLAST of Lsi08G016330 vs. NCBI nr
Match: XP_004142960.1 (vignain [Cucumis sativus] >KGN62334.1 hypothetical protein Csa_018585 [Cucumis sativus]) HSP 1 Score: 83.2 bits (204), Expect = 1.1e-12 Identity = 33/57 (57.89%), Postives = 45/57 (78.95%), Query Frame = 0
BLAST of Lsi08G016330 vs. TAIR 10
Match: AT5G50260.1 (Cysteine proteinases superfamily protein ) HSP 1 Score: 73.2 bits (178), Expect = 1.0e-13 Identity = 31/58 (53.45%), Postives = 42/58 (72.41%), Query Frame = 0
BLAST of Lsi08G016330 vs. TAIR 10
Match: AT4G11310.1 (Papain family cysteine protease ) HSP 1 Score: 70.5 bits (171), Expect = 6.8e-13 Identity = 34/67 (50.75%), Postives = 45/67 (67.16%), Query Frame = 0
BLAST of Lsi08G016330 vs. TAIR 10
Match: AT1G09850.1 (xylem bark cysteine peptidase 3 ) HSP 1 Score: 69.7 bits (169), Expect = 1.2e-12 Identity = 29/56 (51.79%), Postives = 40/56 (71.43%), Query Frame = 0
BLAST of Lsi08G016330 vs. TAIR 10
Match: AT4G11320.1 (Papain family cysteine protease ) HSP 1 Score: 68.9 bits (167), Expect = 2.0e-12 Identity = 34/67 (50.75%), Postives = 44/67 (65.67%), Query Frame = 0
BLAST of Lsi08G016330 vs. TAIR 10
Match: AT3G19400.1 (Cysteine proteinases superfamily protein ) HSP 1 Score: 68.6 bits (166), Expect = 2.6e-12 Identity = 32/58 (55.17%), Postives = 39/58 (67.24%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bottle gourd (USVL1VR-Ls) v1
Date Performed: 2021-10-18
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|