
Lsi08G013490 (gene) Bottle gourd (USVL1VR-Ls) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCAGGAAGGGATGAATTAACGTGGACGACGTTGATTACTTGGTATGGGCAGAAGGATGATCTGAATGAGGCACGTGGCCTTGTAGACACAATGACTGAAAAGCTGAGTGTAGCATGGAATGCCATGATCTCTGGATATGTGCACCGTGGTATTTTCGAGGATGCCTCGAACACTCTTTATGGAAATGCGTTTGATTGGAGTCCACCACTACGAGTTCACCTACACTAG ATGGCAGGAAGGGATGAATTAACGTGGACGACGTTGATTACTTGGTATGGGCAGAAGGATGATCTGAATGAGGCACGTGGCCTTGTAGACACAATGACTGAAAAGCTGAGTGTAGCATGGAATGCCATGATCTCTGGATATGTGCACCGTGGTATTTTCGAGGATGCCTCGAACACTCTTTATGGAAATGCGTTTGATTGGAGTCCACCACTACGAGTTCACCTACACTAG ATGGCAGGAAGGGATGAATTAACGTGGACGACGTTGATTACTTGGTATGGGCAGAAGGATGATCTGAATGAGGCACGTGGCCTTGTAGACACAATGACTGAAAAGCTGAGTGTAGCATGGAATGCCATGATCTCTGGATATGTGCACCGTGGTATTTTCGAGGATGCCTCGAACACTCTTTATGGAAATGCGTTTGATTGGAGTCCACCACTACGAGTTCACCTACACTAG MAGRDELTWTTLITWYGQKDDLNEARGLVDTMTEKLSVAWNAMISGYVHRGIFEDASNTLYGNAFDWSPPLRVHLH Homology
BLAST of Lsi08G013490 vs. ExPASy Swiss-Prot
Match: Q56XI1 (Pentatricopeptide repeat-containing protein At1g09410, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PCMP-H18 PE=1 SV=2) HSP 1 Score: 64.3 bits (155), Expect = 6.8e-10 Identity = 26/56 (46.43%), Postives = 38/56 (67.86%), Query Frame = 0
BLAST of Lsi08G013490 vs. ExPASy Swiss-Prot
Match: Q9M4P3 (Pentatricopeptide repeat-containing protein At4g16835, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=DYW10 PE=2 SV=3) HSP 1 Score: 58.9 bits (141), Expect = 2.8e-08 Identity = 26/58 (44.83%), Postives = 38/58 (65.52%), Query Frame = 0
BLAST of Lsi08G013490 vs. ExPASy Swiss-Prot
Match: Q9M9R6 (Pentatricopeptide repeat-containing protein At1g14470 OS=Arabidopsis thaliana OX=3702 GN=PCMP-A4 PE=2 SV=2) HSP 1 Score: 58.2 bits (139), Expect = 4.8e-08 Identity = 26/56 (46.43%), Postives = 33/56 (58.93%), Query Frame = 0
BLAST of Lsi08G013490 vs. ExPASy Swiss-Prot
Match: Q9FXB9 (Pentatricopeptide repeat-containing protein At1g56690, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PCMP-H69 PE=2 SV=1) HSP 1 Score: 55.1 bits (131), Expect = 4.1e-07 Identity = 25/56 (44.64%), Postives = 35/56 (62.50%), Query Frame = 0
BLAST of Lsi08G013490 vs. ExPASy Swiss-Prot
Match: Q9SY02 (Pentatricopeptide repeat-containing protein At4g02750 OS=Arabidopsis thaliana OX=3702 GN=PCMP-H24 PE=3 SV=1) HSP 1 Score: 54.3 bits (129), Expect = 7.0e-07 Identity = 24/68 (35.29%), Postives = 40/68 (58.82%), Query Frame = 0
BLAST of Lsi08G013490 vs. ExPASy TrEMBL
Match: A0A6J1KSZ4 (pentatricopeptide repeat-containing protein At1g25360-like OS=Cucurbita maxima OX=3661 GN=LOC111496149 PE=3 SV=1) HSP 1 Score: 94.4 bits (233), Expect = 2.3e-16 Identity = 44/56 (78.57%), Postives = 47/56 (83.93%), Query Frame = 0
BLAST of Lsi08G013490 vs. ExPASy TrEMBL
Match: A0A6J1GGL5 (pentatricopeptide repeat-containing protein At1g25360-like OS=Cucurbita moschata OX=3662 GN=LOC111454019 PE=3 SV=1) HSP 1 Score: 94.4 bits (233), Expect = 2.3e-16 Identity = 44/56 (78.57%), Postives = 47/56 (83.93%), Query Frame = 0
BLAST of Lsi08G013490 vs. ExPASy TrEMBL
Match: A0A6J1CRF6 (pentatricopeptide repeat-containing protein At1g25360-like OS=Momordica charantia OX=3673 GN=LOC111014069 PE=3 SV=1) HSP 1 Score: 90.9 bits (224), Expect = 2.5e-15 Identity = 40/56 (71.43%), Postives = 47/56 (83.93%), Query Frame = 0
BLAST of Lsi08G013490 vs. ExPASy TrEMBL
Match: A0A2I4ENP7 (pentatricopeptide repeat-containing protein At1g25360 OS=Juglans regia OX=51240 GN=LOC108991303 PE=3 SV=1) HSP 1 Score: 86.7 bits (213), Expect = 4.7e-14 Identity = 39/56 (69.64%), Postives = 45/56 (80.36%), Query Frame = 0
BLAST of Lsi08G013490 vs. ExPASy TrEMBL
Match: A0A7J7DLB9 (Pentatricopeptide repeat-containing protein OS=Tripterygium wilfordii OX=458696 GN=HS088_TW06G01336 PE=3 SV=1) HSP 1 Score: 84.3 bits (207), Expect = 2.3e-13 Identity = 37/56 (66.07%), Postives = 46/56 (82.14%), Query Frame = 0
BLAST of Lsi08G013490 vs. NCBI nr
Match: KAG7020472.1 (Pentatricopeptide repeat-containing protein, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 94.4 bits (233), Expect = 4.6e-16 Identity = 44/56 (78.57%), Postives = 47/56 (83.93%), Query Frame = 0
BLAST of Lsi08G013490 vs. NCBI nr
Match: XP_023537093.1 (pentatricopeptide repeat-containing protein At1g25360-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 94.4 bits (233), Expect = 4.6e-16 Identity = 44/56 (78.57%), Postives = 47/56 (83.93%), Query Frame = 0
BLAST of Lsi08G013490 vs. NCBI nr
Match: KAG6585558.1 (Pentatricopeptide repeat-containing protein, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 94.4 bits (233), Expect = 4.6e-16 Identity = 44/56 (78.57%), Postives = 47/56 (83.93%), Query Frame = 0
BLAST of Lsi08G013490 vs. NCBI nr
Match: XP_023002238.1 (pentatricopeptide repeat-containing protein At1g25360-like [Cucurbita maxima]) HSP 1 Score: 94.4 bits (233), Expect = 4.6e-16 Identity = 44/56 (78.57%), Postives = 47/56 (83.93%), Query Frame = 0
BLAST of Lsi08G013490 vs. NCBI nr
Match: XP_022951057.1 (pentatricopeptide repeat-containing protein At1g25360-like [Cucurbita moschata]) HSP 1 Score: 94.4 bits (233), Expect = 4.6e-16 Identity = 44/56 (78.57%), Postives = 47/56 (83.93%), Query Frame = 0
BLAST of Lsi08G013490 vs. TAIR 10
Match: AT1G09410.1 (pentatricopeptide (PPR) repeat-containing protein ) HSP 1 Score: 64.3 bits (155), Expect = 4.8e-11 Identity = 26/56 (46.43%), Postives = 38/56 (67.86%), Query Frame = 0
BLAST of Lsi08G013490 vs. TAIR 10
Match: AT4G16835.1 (Tetratricopeptide repeat (TPR)-like superfamily protein ) HSP 1 Score: 58.9 bits (141), Expect = 2.0e-09 Identity = 26/58 (44.83%), Postives = 38/58 (65.52%), Query Frame = 0
BLAST of Lsi08G013490 vs. TAIR 10
Match: AT1G14470.1 (Pentatricopeptide repeat (PPR) superfamily protein ) HSP 1 Score: 58.2 bits (139), Expect = 3.4e-09 Identity = 26/56 (46.43%), Postives = 33/56 (58.93%), Query Frame = 0
BLAST of Lsi08G013490 vs. TAIR 10
Match: AT1G56690.1 (Pentatricopeptide repeat (PPR) superfamily protein ) HSP 1 Score: 55.1 bits (131), Expect = 2.9e-08 Identity = 25/56 (44.64%), Postives = 35/56 (62.50%), Query Frame = 0
BLAST of Lsi08G013490 vs. TAIR 10
Match: AT4G02750.1 (Tetratricopeptide repeat (TPR)-like superfamily protein ) HSP 1 Score: 54.3 bits (129), Expect = 5.0e-08 Identity = 24/68 (35.29%), Postives = 40/68 (58.82%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bottle gourd (USVL1VR-Ls) v1
Date Performed: 2021-10-18 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|