
Lsi08G011990 (gene) Bottle gourd (USVL1VR-Ls) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGCGAAGGGGGCCAGTCCAAGATCGTACTGTTGCTCTACAAAGACAACAGACGCTCTCAACGGCTAGGCGCCACTCTCTTTCAGCTTATATTCCTACTAATGTAATTTCCATTACCGATGGACAAATATTCTTATCTGCCGATCTATTCAATTCTGGAATCAGACCTGCTATTAATGTGGGTATTTCCGTCTCCAGAGTAGGATCTGCAGCTCATGGGAAATAG ATGCGAAGGGGGCCAGTCCAAGATCGTACTGTTGCTCTACAAAGACAACAGACGCTCTCAACGGCTAGGCGCCACTCTCTTTCAGCTTATATTCCTACTAATGTAATTTCCATTACCGATGGACAAATATTCTTATCTGCCGATCTATTCAATTCTGGAATCAGACCTGCTATTAATGTGGGTATTTCCGTCTCCAGAGTAGGATCTGCAGCTCATGGGAAATAG ATGCGAAGGGGGCCAGTCCAAGATCGTACTGTTGCTCTACAAAGACAACAGACGCTCTCAACGGCTAGGCGCCACTCTCTTTCAGCTTATATTCCTACTAATGTAATTTCCATTACCGATGGACAAATATTCTTATCTGCCGATCTATTCAATTCTGGAATCAGACCTGCTATTAATGTGGGTATTTCCGTCTCCAGAGTAGGATCTGCAGCTCATGGGAAATAG MRRGPVQDRTVALQRQQTLSTARRHSLSAYIPTNVISITDGQIFLSADLFNSGIRPAINVGISVSRVGSAAHGK Homology
BLAST of Lsi08G011990 vs. ExPASy Swiss-Prot
Match: Q8S8Y3 (ATP synthase subunit alpha, chloroplastic OS=Atropa belladonna OX=33113 GN=atpA PE=3 SV=1) HSP 1 Score: 85.9 bits (211), Expect = 2.1e-16 Identity = 45/48 (93.75%), Postives = 46/48 (95.83%), Query Frame = 0
BLAST of Lsi08G011990 vs. ExPASy Swiss-Prot
Match: Q8MA05 (ATP synthase subunit alpha, chloroplastic OS=Chaetosphaeridium globosum OX=96477 GN=atpA PE=3 SV=1) HSP 1 Score: 85.9 bits (211), Expect = 2.1e-16 Identity = 45/48 (93.75%), Postives = 46/48 (95.83%), Query Frame = 0
BLAST of Lsi08G011990 vs. ExPASy Swiss-Prot
Match: A4QL91 (ATP synthase subunit alpha, chloroplastic OS=Lepidium virginicum OX=59292 GN=atpA PE=3 SV=1) HSP 1 Score: 85.9 bits (211), Expect = 2.1e-16 Identity = 45/48 (93.75%), Postives = 46/48 (95.83%), Query Frame = 0
BLAST of Lsi08G011990 vs. ExPASy Swiss-Prot
Match: Q09FX6 (ATP synthase subunit alpha, chloroplastic OS=Nandina domestica OX=41776 GN=atpA PE=3 SV=1) HSP 1 Score: 85.9 bits (211), Expect = 2.1e-16 Identity = 45/48 (93.75%), Postives = 46/48 (95.83%), Query Frame = 0
BLAST of Lsi08G011990 vs. ExPASy Swiss-Prot
Match: Q3C1H4 (ATP synthase subunit alpha, chloroplastic OS=Nicotiana sylvestris OX=4096 GN=atpA PE=3 SV=1) HSP 1 Score: 85.9 bits (211), Expect = 2.1e-16 Identity = 45/48 (93.75%), Postives = 46/48 (95.83%), Query Frame = 0
BLAST of Lsi08G011990 vs. ExPASy TrEMBL
Match: A0A140H9Z2 (ATP synthase subunit alpha, chloroplastic OS=Kirchneriella aperta OX=117505 GN=atpA PE=3 SV=1) HSP 1 Score: 86.7 bits (213), Expect = 4.6e-14 Identity = 45/48 (93.75%), Postives = 46/48 (95.83%), Query Frame = 0
BLAST of Lsi08G011990 vs. ExPASy TrEMBL
Match: A0A386AXA0 (ATP synthase subunit alpha, chloroplastic OS=Flabellia petiolata OX=189428 GN=atpA PE=3 SV=1) HSP 1 Score: 86.7 bits (213), Expect = 4.6e-14 Identity = 44/48 (91.67%), Postives = 46/48 (95.83%), Query Frame = 0
BLAST of Lsi08G011990 vs. ExPASy TrEMBL
Match: A0A0D6E2B0 (ATP synthase subunit alpha, chloroplastic OS=Tydemania expeditionis OX=325645 GN=atpA PE=3 SV=1) HSP 1 Score: 86.7 bits (213), Expect = 4.6e-14 Identity = 44/48 (91.67%), Postives = 46/48 (95.83%), Query Frame = 0
BLAST of Lsi08G011990 vs. ExPASy TrEMBL
Match: A0A386AY50 (ATP synthase subunit alpha, chloroplastic OS=Pseudochlorodesmis sp. HV01306b OX=2358489 GN=atpA PE=3 SV=1) HSP 1 Score: 86.7 bits (213), Expect = 4.6e-14 Identity = 44/48 (91.67%), Postives = 46/48 (95.83%), Query Frame = 0
BLAST of Lsi08G011990 vs. ExPASy TrEMBL
Match: A0A2Z6FBN8 (ATP synthase subunit alpha, chloroplastic OS=Raphidocelis subcapitata OX=307507 GN=atpA PE=3 SV=1) HSP 1 Score: 86.7 bits (213), Expect = 4.6e-14 Identity = 45/48 (93.75%), Postives = 46/48 (95.83%), Query Frame = 0
BLAST of Lsi08G011990 vs. NCBI nr
Match: AYQ94510.1 (CF1 alpha subunit of ATP synthase [Cylindrocapsa geminella]) HSP 1 Score: 86.7 bits (213), Expect = 9.4e-14 Identity = 45/48 (93.75%), Postives = 46/48 (95.83%), Query Frame = 0
BLAST of Lsi08G011990 vs. NCBI nr
Match: AYC64609.1 (ATP synthase CF1 subunit alpha [Halimeda minima]) HSP 1 Score: 86.7 bits (213), Expect = 9.4e-14 Identity = 44/48 (91.67%), Postives = 46/48 (95.83%), Query Frame = 0
BLAST of Lsi08G011990 vs. NCBI nr
Match: YP_009519687.1 (ATP synthase CF1 subunit alpha [Udotea flabellum] >AYC65635.1 ATP synthase CF1 subunit alpha [Udotea flabellum]) HSP 1 Score: 86.7 bits (213), Expect = 9.4e-14 Identity = 44/48 (91.67%), Postives = 46/48 (95.83%), Query Frame = 0
BLAST of Lsi08G011990 vs. NCBI nr
Match: AYC64355.1 (ATP synthase CF1 subunit alpha [Pseudochlorodesmis sp. HV01306a]) HSP 1 Score: 86.7 bits (213), Expect = 9.4e-14 Identity = 44/48 (91.67%), Postives = 46/48 (95.83%), Query Frame = 0
BLAST of Lsi08G011990 vs. NCBI nr
Match: YP_009238070.1 (CF1 alpha subunit of ATP synthase [Neochloris aquatica] >AMO00879.1 CF1 alpha subunit of ATP synthase [Neochloris aquatica]) HSP 1 Score: 86.7 bits (213), Expect = 9.4e-14 Identity = 45/48 (93.75%), Postives = 46/48 (95.83%), Query Frame = 0
BLAST of Lsi08G011990 vs. TAIR 10
Match: ATCG00120.1 (ATP synthase subunit alpha ) HSP 1 Score: 84.7 bits (208), Expect = 3.3e-17 Identity = 44/48 (91.67%), Postives = 46/48 (95.83%), Query Frame = 0
BLAST of Lsi08G011990 vs. TAIR 10
Match: AT2G07698.1 (ATPase, F1 complex, alpha subunit protein ) HSP 1 Score: 72.4 bits (176), Expect = 1.7e-13 Identity = 38/48 (79.17%), Postives = 41/48 (85.42%), Query Frame = 0
BLAST of Lsi08G011990 vs. TAIR 10
Match: ATMG01190.1 (ATP synthase subunit 1 ) HSP 1 Score: 72.4 bits (176), Expect = 1.7e-13 Identity = 38/48 (79.17%), Postives = 41/48 (85.42%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bottle gourd (USVL1VR-Ls) v1
Date Performed: 2021-10-18 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|