![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
Lsi06G014680 (gene) Bottle gourd (USVL1VR-Ls) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAGAAAAGGTTGGTGGTGGTGAAGAAATCTGATGGCTCTGGTGGCCGACGCTCCGGTTCGGGCTCGGTCGTGCGCTACGCGGAGTGCCAGAAGAATCACGCAGCAAAGCTCGGGGGGTTCGCAGTCGACGGTTGCCGGGAATTCATGGCAAGAGGAGAGGATGGAACTGAGGAGGCTCTCAATTGTGCTGCTTGTGGCTGCCACAGGAATTTTCATAGAAGGGAAGTGGATGCTGAAGTTGTTTTTGAGTATTCTCCTCCAAACTCCAATTAA ATGAAGAAAAGGTTGGTGGTGGTGAAGAAATCTGATGGCTCTGGTGGCCGACGCTCCGGTTCGGGCTCGGTCGTGCGCTACGCGGAGTGCCAGAAGAATCACGCAGCAAAGCTCGGGGGGTTCGCAGTCGACGGTTGCCGGGAATTCATGGCAAGAGGAGAGGATGGAACTGAGGAGGCTCTCAATTGTGCTGCTTGTGGCTGCCACAGGAATTTTCATAGAAGGGAAGTGGATGCTGAAGTTGTTTTTGAGTATTCTCCTCCAAACTCCAATTAA ATGAAGAAAAGGTTGGTGGTGGTGAAGAAATCTGATGGCTCTGGTGGCCGACGCTCCGGTTCGGGCTCGGTCGTGCGCTACGCGGAGTGCCAGAAGAATCACGCAGCAAAGCTCGGGGGGTTCGCAGTCGACGGTTGCCGGGAATTCATGGCAAGAGGAGAGGATGGAACTGAGGAGGCTCTCAATTGTGCTGCTTGTGGCTGCCACAGGAATTTTCATAGAAGGGAAGTGGATGCTGAAGTTGTTTTTGAGTATTCTCCTCCAAACTCCAATTAA MKKRLVVVKKSDGSGGRRSGSGSVVRYAECQKNHAAKLGGFAVDGCREFMARGEDGTEEALNCAACGCHRNFHRREVDAEVVFEYSPPNSN Homology
BLAST of Lsi06G014680 vs. ExPASy Swiss-Prot
Match: Q2Q493 (Mini zinc finger protein 3 OS=Arabidopsis thaliana OX=3702 GN=MIF3 PE=1 SV=1) HSP 1 Score: 125.9 bits (315), Expect = 2.3e-28 Identity = 64/91 (70.33%), Postives = 70/91 (76.92%), Query Frame = 0
BLAST of Lsi06G014680 vs. ExPASy Swiss-Prot
Match: Q9CA51 (Mini zinc finger protein 1 OS=Arabidopsis thaliana OX=3702 GN=MIF1 PE=1 SV=1) HSP 1 Score: 123.6 bits (309), Expect = 1.1e-27 Identity = 61/101 (60.40%), Postives = 71/101 (70.30%), Query Frame = 0
BLAST of Lsi06G014680 vs. ExPASy Swiss-Prot
Match: Q9LJW5 (Mini zinc finger protein 2 OS=Arabidopsis thaliana OX=3702 GN=MIF2 PE=1 SV=1) HSP 1 Score: 110.9 bits (276), Expect = 7.5e-24 Identity = 56/97 (57.73%), Postives = 70/97 (72.16%), Query Frame = 0
BLAST of Lsi06G014680 vs. ExPASy Swiss-Prot
Match: B8BIU8 (Mini zinc finger protein 1 OS=Oryza sativa subsp. indica OX=39946 GN=MIF1 PE=3 SV=1) HSP 1 Score: 99.0 bits (245), Expect = 3.0e-20 Identity = 44/62 (70.97%), Postives = 50/62 (80.65%), Query Frame = 0
BLAST of Lsi06G014680 vs. ExPASy Swiss-Prot
Match: Q2RB28 (Mini zinc finger protein 1 OS=Oryza sativa subsp. japonica OX=39947 GN=MIF1 PE=3 SV=1) HSP 1 Score: 99.0 bits (245), Expect = 3.0e-20 Identity = 44/62 (70.97%), Postives = 50/62 (80.65%), Query Frame = 0
BLAST of Lsi06G014680 vs. ExPASy TrEMBL
Match: A0A6J1E6Q9 (mini zinc finger protein 3-like OS=Cucurbita moschata OX=3662 GN=LOC111429921 PE=4 SV=1) HSP 1 Score: 179.5 bits (454), Expect = 6.4e-42 Identity = 87/93 (93.55%), Postives = 91/93 (97.85%), Query Frame = 0
BLAST of Lsi06G014680 vs. ExPASy TrEMBL
Match: A0A6J1J9R5 (mini zinc finger protein 3-like OS=Cucurbita maxima OX=3661 GN=LOC111484829 PE=4 SV=1) HSP 1 Score: 178.3 bits (451), Expect = 1.4e-41 Identity = 86/93 (92.47%), Postives = 91/93 (97.85%), Query Frame = 0
BLAST of Lsi06G014680 vs. ExPASy TrEMBL
Match: A0A6J1C4B2 (mini zinc finger protein 3-like OS=Momordica charantia OX=3673 GN=LOC111007261 PE=4 SV=1) HSP 1 Score: 177.6 bits (449), Expect = 2.4e-41 Identity = 87/92 (94.57%), Postives = 89/92 (96.74%), Query Frame = 0
BLAST of Lsi06G014680 vs. ExPASy TrEMBL
Match: A0A0A0LSA6 (ZF-HD dimerization-type domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_1G009710 PE=4 SV=1) HSP 1 Score: 177.2 bits (448), Expect = 3.2e-41 Identity = 87/95 (91.58%), Postives = 88/95 (92.63%), Query Frame = 0
BLAST of Lsi06G014680 vs. ExPASy TrEMBL
Match: A0A5A7UWS7 (Mini zinc finger protein 3-like OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold274G002440 PE=4 SV=1) HSP 1 Score: 176.8 bits (447), Expect = 4.1e-41 Identity = 87/96 (90.62%), Postives = 88/96 (91.67%), Query Frame = 0
BLAST of Lsi06G014680 vs. NCBI nr
Match: XP_038880256.1 (mini zinc finger protein 3 [Benincasa hispida]) HSP 1 Score: 180.6 bits (457), Expect = 5.9e-42 Identity = 89/95 (93.68%), Postives = 89/95 (93.68%), Query Frame = 0
BLAST of Lsi06G014680 vs. NCBI nr
Match: XP_022921765.1 (mini zinc finger protein 3-like [Cucurbita moschata] >KAG6589505.1 Mini zinc finger protein 1, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 179.5 bits (454), Expect = 1.3e-41 Identity = 87/93 (93.55%), Postives = 91/93 (97.85%), Query Frame = 0
BLAST of Lsi06G014680 vs. NCBI nr
Match: XP_022987207.1 (mini zinc finger protein 3-like [Cucurbita maxima]) HSP 1 Score: 178.3 bits (451), Expect = 2.9e-41 Identity = 86/93 (92.47%), Postives = 91/93 (97.85%), Query Frame = 0
BLAST of Lsi06G014680 vs. NCBI nr
Match: XP_022135253.1 (mini zinc finger protein 3-like [Momordica charantia]) HSP 1 Score: 177.6 bits (449), Expect = 5.0e-41 Identity = 87/92 (94.57%), Postives = 89/92 (96.74%), Query Frame = 0
BLAST of Lsi06G014680 vs. NCBI nr
Match: KAG7023191.1 (Mini zinc finger protein 1, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 177.6 bits (449), Expect = 5.0e-41 Identity = 86/93 (92.47%), Postives = 90/93 (96.77%), Query Frame = 0
BLAST of Lsi06G014680 vs. TAIR 10
Match: AT1G18835.1 (mini zinc finger ) HSP 1 Score: 125.9 bits (315), Expect = 1.6e-29 Identity = 64/91 (70.33%), Postives = 70/91 (76.92%), Query Frame = 0
BLAST of Lsi06G014680 vs. TAIR 10
Match: AT1G74660.1 (mini zinc finger 1 ) HSP 1 Score: 123.6 bits (309), Expect = 8.0e-29 Identity = 61/101 (60.40%), Postives = 71/101 (70.30%), Query Frame = 0
BLAST of Lsi06G014680 vs. TAIR 10
Match: AT3G28917.1 (mini zinc finger 2 ) HSP 1 Score: 110.9 bits (276), Expect = 5.4e-25 Identity = 56/97 (57.73%), Postives = 70/97 (72.16%), Query Frame = 0
BLAST of Lsi06G014680 vs. TAIR 10
Match: AT4G24660.1 (homeobox protein 22 ) HSP 1 Score: 98.6 bits (244), Expect = 2.7e-21 Identity = 43/67 (64.18%), Postives = 50/67 (74.63%), Query Frame = 0
BLAST of Lsi06G014680 vs. TAIR 10
Match: AT2G02540.1 (homeobox protein 21 ) HSP 1 Score: 90.9 bits (224), Expect = 5.7e-19 Identity = 38/64 (59.38%), Postives = 47/64 (73.44%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bottle gourd (USVL1VR-Ls) v1
Date Performed: 2021-10-18
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|