![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
Lsi06G014520 (gene) Bottle gourd (USVL1VR-Ls) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGATCTATTGCGACACAACATTACAAGCACTCGACGAGAAATCAAGAAACTTTTGAGGAACAAAAAATTGGAAGAATTTGTTAAGGGTTGTTTGAAGGATTGCTTAGAGCTTTATTCTGACGCTGTTCCAACGTTGAAAGAGGCAAAAAGAGAATACAAAGAGAAGAATTATAAAGATGCAAATGTTAAGGTAAGCTCAATTATGGAAGCTCCTACTACTTGTGAAGATGGGTTTCAAGAAAAACAAGAAACAATTTCGCCATTGACGAATAATAACAACAATGTGTTTCAATTGGCAGCTTTGACTCTCTCCATCATCAATATGAATCTGCATCTCCAATAA ATGGATCTATTGCGACACAACATTACAAGCACTCGACGAGAAATCAAGAAACTTTTGAGGAACAAAAAATTGGAAGAATTTGTTAAGGGTTGTTTGAAGGATTGCTTAGAGCTTTATTCTGACGCTGTTCCAACGTTGAAAGAGGCAAAAAGAGAATACAAAGAGAAGAATTATAAAGATGCAAATGTTAAGGTAAGCTCAATTATGGAAGCTCCTACTACTTGTGAAGATGGGTTTCAAGAAAAACAAGAAACAATTTCGCCATTGACGAATAATAACAACAATGTGTTTCAATTGGCAGCTTTGACTCTCTCCATCATCAATATGAATCTGCATCTCCAATAA ATGGATCTATTGCGACACAACATTACAAGCACTCGACGAGAAATCAAGAAACTTTTGAGGAACAAAAAATTGGAAGAATTTGTTAAGGGTTGTTTGAAGGATTGCTTAGAGCTTTATTCTGACGCTGTTCCAACGTTGAAAGAGGCAAAAAGAGAATACAAAGAGAAGAATTATAAAGATGCAAATGTTAAGGTAAGCTCAATTATGGAAGCTCCTACTACTTGTGAAGATGGGTTTCAAGAAAAACAAGAAACAATTTCGCCATTGACGAATAATAACAACAATGTGTTTCAATTGGCAGCTTTGACTCTCTCCATCATCAATATGAATCTGCATCTCCAATAA MDLLRHNITSTRREIKKLLRNKKLEEFVKGCLKDCLELYSDAVPTLKEAKREYKEKNYKDANVKVSSIMEAPTTCEDGFQEKQETISPLTNNNNNVFQLAALTLSIINMNLHLQ Homology
BLAST of Lsi06G014520 vs. ExPASy Swiss-Prot
Match: Q8GT41 (Putative invertase inhibitor OS=Platanus acerifolia OX=140101 PE=1 SV=1) HSP 1 Score: 75.5 bits (184), Expect = 4.4e-13 Identity = 38/95 (40.00%), Postives = 66/95 (69.47%), Query Frame = 0
BLAST of Lsi06G014520 vs. ExPASy Swiss-Prot
Match: A9YUH4 (Putative invertase inhibitor OS=Platanus orientalis OX=122832 PE=1 SV=1) HSP 1 Score: 73.9 bits (180), Expect = 1.3e-12 Identity = 38/95 (40.00%), Postives = 65/95 (68.42%), Query Frame = 0
BLAST of Lsi06G014520 vs. ExPASy TrEMBL
Match: A0A0A0LUJ3 (PMEI domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_1G009900 PE=4 SV=1) HSP 1 Score: 197.2 bits (500), Expect = 3.7e-47 Identity = 97/112 (86.61%), Postives = 108/112 (96.43%), Query Frame = 0
BLAST of Lsi06G014520 vs. ExPASy TrEMBL
Match: A0A6J1EZS0 (putative invertase inhibitor OS=Cucurbita moschata OX=3662 GN=LOC111440851 PE=4 SV=1) HSP 1 Score: 184.5 bits (467), Expect = 2.5e-43 Identity = 91/114 (79.82%), Postives = 101/114 (88.60%), Query Frame = 0
BLAST of Lsi06G014520 vs. ExPASy TrEMBL
Match: A0A6J1I7I4 (putative invertase inhibitor OS=Cucurbita maxima OX=3661 GN=LOC111471526 PE=4 SV=1) HSP 1 Score: 176.8 bits (447), Expect = 5.2e-41 Identity = 90/114 (78.95%), Postives = 100/114 (87.72%), Query Frame = 0
BLAST of Lsi06G014520 vs. ExPASy TrEMBL
Match: A0A6J1C4E5 (putative invertase inhibitor OS=Momordica charantia OX=3673 GN=LOC111007285 PE=4 SV=1) HSP 1 Score: 175.3 bits (443), Expect = 1.5e-40 Identity = 89/114 (78.07%), Postives = 101/114 (88.60%), Query Frame = 0
BLAST of Lsi06G014520 vs. ExPASy TrEMBL
Match: A0A2K1XQD5 (PMEI domain-containing protein OS=Populus trichocarpa OX=3694 GN=POPTR_014G044100 PE=4 SV=1) HSP 1 Score: 141.0 bits (354), Expect = 3.1e-30 Identity = 61/107 (57.01%), Postives = 91/107 (85.05%), Query Frame = 0
BLAST of Lsi06G014520 vs. NCBI nr
Match: XP_038880152.1 (putative invertase inhibitor [Benincasa hispida]) HSP 1 Score: 211.8 bits (538), Expect = 3.0e-51 Identity = 107/114 (93.86%), Postives = 111/114 (97.37%), Query Frame = 0
BLAST of Lsi06G014520 vs. NCBI nr
Match: KAE8652421.1 (hypothetical protein Csa_013805 [Cucumis sativus]) HSP 1 Score: 197.2 bits (500), Expect = 7.6e-47 Identity = 97/112 (86.61%), Postives = 108/112 (96.43%), Query Frame = 0
BLAST of Lsi06G014520 vs. NCBI nr
Match: XP_022933437.1 (putative invertase inhibitor [Cucurbita moschata]) HSP 1 Score: 184.5 bits (467), Expect = 5.1e-43 Identity = 91/114 (79.82%), Postives = 101/114 (88.60%), Query Frame = 0
BLAST of Lsi06G014520 vs. NCBI nr
Match: KAG6587552.1 (hypothetical protein SDJN03_16117, partial [Cucurbita argyrosperma subsp. sororia] >KAG7021528.1 hypothetical protein SDJN02_15253, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 182.6 bits (462), Expect = 1.9e-42 Identity = 91/114 (79.82%), Postives = 101/114 (88.60%), Query Frame = 0
BLAST of Lsi06G014520 vs. NCBI nr
Match: XP_023531537.1 (putative invertase inhibitor [Cucurbita pepo subsp. pepo]) HSP 1 Score: 182.6 bits (462), Expect = 1.9e-42 Identity = 91/114 (79.82%), Postives = 101/114 (88.60%), Query Frame = 0
BLAST of Lsi06G014520 vs. TAIR 10
Match: AT5G46940.1 (Plant invertase/pectin methylesterase inhibitor superfamily protein ) HSP 1 Score: 74.7 bits (182), Expect = 5.3e-14 Identity = 36/101 (35.64%), Postives = 64/101 (63.37%), Query Frame = 0
BLAST of Lsi06G014520 vs. TAIR 10
Match: AT5G46970.1 (Plant invertase/pectin methylesterase inhibitor superfamily protein ) HSP 1 Score: 71.6 bits (174), Expect = 4.5e-13 Identity = 40/90 (44.44%), Postives = 59/90 (65.56%), Query Frame = 0
BLAST of Lsi06G014520 vs. TAIR 10
Match: AT5G38610.1 (Plant invertase/pectin methylesterase inhibitor superfamily protein ) HSP 1 Score: 67.0 bits (162), Expect = 1.1e-11 Identity = 42/114 (36.84%), Postives = 61/114 (53.51%), Query Frame = 0
BLAST of Lsi06G014520 vs. TAIR 10
Match: AT5G46930.1 (Plant invertase/pectin methylesterase inhibitor superfamily protein ) HSP 1 Score: 58.9 bits (141), Expect = 3.0e-09 Identity = 33/102 (32.35%), Postives = 63/102 (61.76%), Query Frame = 0
BLAST of Lsi06G014520 vs. TAIR 10
Match: AT1G54620.1 (Plant invertase/pectin methylesterase inhibitor superfamily protein ) HSP 1 Score: 52.8 bits (125), Expect = 2.2e-07 Identity = 33/107 (30.84%), Postives = 56/107 (52.34%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bottle gourd (USVL1VR-Ls) v1
Date Performed: 2021-10-18
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|