![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
Lsi06G014320 (gene) Bottle gourd (USVL1VR-Ls) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCGGCTCCAACGAGATCGGAGGCCCTTGCGCTTCTTCGCTCTCTGCTCCGTACAGCTAGTCACTTCTGCGATTACAACATCAAAGAGTACGCCAAACGACGTGCAGTCGACGGCTTCCGCCATAACCGGAACCTTTCCGTTCCTCCATCCATCTCCTCCGCCTACGCGGACGGCAAGGCTCAGCTTGAAGTTGCTAAAAGACAATCCGCCGTCTACTCCCTCTATGCGCCCAAGGTAAAGAGCATCATGGAGGCACATCGCACAAACTGA ATGGCGGCTCCAACGAGATCGGAGGCCCTTGCGCTTCTTCGCTCTCTGCTCCGTACAGCTAGTCACTTCTGCGATTACAACATCAAAGAGTACGCCAAACGACGTGCAGTCGACGGCTTCCGCCATAACCGGAACCTTTCCGTTCCTCCATCCATCTCCTCCGCCTACGCGGACGGCAAGGCTCAGCTTGAAGTTGCTAAAAGACAATCCGCCGTCTACTCCCTCTATGCGCCCAAGGTAAAGAGCATCATGGAGGCACATCGCACAAACTGA ATGGCGGCTCCAACGAGATCGGAGGCCCTTGCGCTTCTTCGCTCTCTGCTCCGTACAGCTAGTCACTTCTGCGATTACAACATCAAAGAGTACGCCAAACGACGTGCAGTCGACGGCTTCCGCCATAACCGGAACCTTTCCGTTCCTCCATCCATCTCCTCCGCCTACGCGGACGGCAAGGCTCAGCTTGAAGTTGCTAAAAGACAATCCGCCGTCTACTCCCTCTATGCGCCCAAGGTAAAGAGCATCATGGAGGCACATCGCACAAACTGA MAAPTRSEALALLRSLLRTASHFCDYNIKEYAKRRAVDGFRHNRNLSVPPSISSAYADGKAQLEVAKRQSAVYSLYAPKVKSIMEAHRTN Homology
BLAST of Lsi06G014320 vs. ExPASy Swiss-Prot
Match: Q8K215 (LYR motif-containing protein 4 OS=Mus musculus OX=10090 GN=Lyrm4 PE=1 SV=1) HSP 1 Score: 58.9 bits (141), Expect = 3.4e-08 Identity = 30/77 (38.96%), Postives = 45/77 (58.44%), Query Frame = 0
BLAST of Lsi06G014320 vs. ExPASy Swiss-Prot
Match: Q6Q560 (Protein ISD11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ISD11 PE=1 SV=1) HSP 1 Score: 50.8 bits (120), Expect = 9.2e-06 Identity = 25/74 (33.78%), Postives = 40/74 (54.05%), Query Frame = 0
BLAST of Lsi06G014320 vs. ExPASy Swiss-Prot
Match: B8JLQ0 (LYR motif-containing protein 4 OS=Danio rerio OX=7955 GN=lyrm4 PE=3 SV=1) HSP 1 Score: 50.4 bits (119), Expect = 1.2e-05 Identity = 26/77 (33.77%), Postives = 44/77 (57.14%), Query Frame = 0
BLAST of Lsi06G014320 vs. ExPASy Swiss-Prot
Match: O46098 (Protein bcn92 OS=Drosophila melanogaster OX=7227 GN=bcn92 PE=1 SV=1) HSP 1 Score: 48.1 bits (113), Expect = 5.9e-05 Identity = 30/85 (35.29%), Postives = 46/85 (54.12%), Query Frame = 0
BLAST of Lsi06G014320 vs. ExPASy Swiss-Prot
Match: Q54FN9 (LYR motif-containing protein 4 OS=Dictyostelium discoideum OX=44689 GN=lyrm4 PE=3 SV=1) HSP 1 Score: 46.6 bits (109), Expect = 1.7e-04 Identity = 27/72 (37.50%), Postives = 38/72 (52.78%), Query Frame = 0
BLAST of Lsi06G014320 vs. ExPASy TrEMBL
Match: A0A0A0LPH2 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G012090 PE=4 SV=1) HSP 1 Score: 159.1 bits (401), Expect = 8.8e-36 Identity = 81/90 (90.00%), Postives = 85/90 (94.44%), Query Frame = 0
BLAST of Lsi06G014320 vs. ExPASy TrEMBL
Match: A0A5A7UTC8 (LYR motif-containing protein 4 OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold274G002810 PE=4 SV=1) HSP 1 Score: 156.4 bits (394), Expect = 5.7e-35 Identity = 79/90 (87.78%), Postives = 84/90 (93.33%), Query Frame = 0
BLAST of Lsi06G014320 vs. ExPASy TrEMBL
Match: A0A1S3BV74 (LYR motif-containing protein 4 OS=Cucumis melo OX=3656 GN=LOC103494022 PE=4 SV=1) HSP 1 Score: 156.4 bits (394), Expect = 5.7e-35 Identity = 79/90 (87.78%), Postives = 84/90 (93.33%), Query Frame = 0
BLAST of Lsi06G014320 vs. ExPASy TrEMBL
Match: A0A6J1IC29 (LYR motif-containing protein 4 OS=Cucurbita maxima OX=3661 GN=LOC111471615 PE=4 SV=1) HSP 1 Score: 152.1 bits (383), Expect = 1.1e-33 Identity = 77/90 (85.56%), Postives = 82/90 (91.11%), Query Frame = 0
BLAST of Lsi06G014320 vs. ExPASy TrEMBL
Match: A0A6J1F322 (LYR motif-containing protein 4 OS=Cucurbita moschata OX=3662 GN=LOC111439443 PE=4 SV=1) HSP 1 Score: 152.1 bits (383), Expect = 1.1e-33 Identity = 77/90 (85.56%), Postives = 82/90 (91.11%), Query Frame = 0
BLAST of Lsi06G014320 vs. NCBI nr
Match: XP_038879775.1 (LYR motif-containing protein 4-like [Benincasa hispida]) HSP 1 Score: 163.7 bits (413), Expect = 7.4e-37 Identity = 83/90 (92.22%), Postives = 85/90 (94.44%), Query Frame = 0
BLAST of Lsi06G014320 vs. NCBI nr
Match: XP_011660289.1 (LYR motif-containing protein 4 [Cucumis sativus]) HSP 1 Score: 159.1 bits (401), Expect = 1.8e-35 Identity = 81/90 (90.00%), Postives = 85/90 (94.44%), Query Frame = 0
BLAST of Lsi06G014320 vs. NCBI nr
Match: XP_008453246.1 (PREDICTED: LYR motif-containing protein 4 [Cucumis melo] >KAA0057977.1 LYR motif-containing protein 4 [Cucumis melo var. makuwa]) HSP 1 Score: 156.4 bits (394), Expect = 1.2e-34 Identity = 79/90 (87.78%), Postives = 84/90 (93.33%), Query Frame = 0
BLAST of Lsi06G014320 vs. NCBI nr
Match: XP_022932898.1 (LYR motif-containing protein 4 [Cucurbita moschata] >XP_022973088.1 LYR motif-containing protein 4 [Cucurbita maxima] >XP_023531294.1 LYR motif-containing protein 4 [Cucurbita pepo subsp. pepo] >KAG7021536.1 LYR motif-containing protein 4, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 152.1 bits (383), Expect = 2.2e-33 Identity = 77/90 (85.56%), Postives = 82/90 (91.11%), Query Frame = 0
BLAST of Lsi06G014320 vs. NCBI nr
Match: XP_022134602.1 (LYR motif-containing protein 4-like [Momordica charantia]) HSP 1 Score: 147.9 bits (372), Expect = 4.2e-32 Identity = 73/90 (81.11%), Postives = 81/90 (90.00%), Query Frame = 0
BLAST of Lsi06G014320 vs. TAIR 10
Match: AT5G61220.1 (LYR family of Fe/S cluster biogenesis protein ) HSP 1 Score: 87.4 bits (215), Expect = 6.3e-18 Identity = 44/79 (55.70%), Postives = 56/79 (70.89%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bottle gourd (USVL1VR-Ls) v1
Date Performed: 2021-10-18
Relationships
The following mRNA feature(s) are a part of this gene:
|