Lsi05G013670 (gene) Bottle gourd (USVL1VR-Ls) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGCCTTTACAATCTTGCTTTCTTCTCCTTCTCTTTCTCCTCCTTCTCCAACATCTTTGTCTCGTTCGAGCTTCATCGGCGCATTCTTGCAATGGCTCCATAGCCGAGTGTGGTAGCGAGGAAGAGATACTGATGGAGTCGGAGATAAGTCGAAGGTTTCTCGAACAACAAAAGAAATACATCTCCATTGGAGCTTTGAAGAAGGATCATCCAGCTTGCGATGGTGGTGGCAGCGGCCAACCTTACACCAAAAGCGGAAGCTGCTCTCCGCCACAAACTAATCCTTACAATCGAGGCTGCTCTAAGATATATCGTTGTAGGTCGGATGATTGA ATGCCTTTACAATCTTGCTTTCTTCTCCTTCTCTTTCTCCTCCTTCTCCAACATCTTTGTCTCGTTCGAGCTTCATCGGCGCATTCTTGCAATGGCTCCATAGCCGAGTGTGGTAGCGAGGAAGAGATACTGATGGAGTCGGAGATAAGTCGAAGGTTTCTCGAACAACAAAAGAAATACATCTCCATTGGAGCTTTGAAGAAGGATCATCCAGCTTGCGATGGTGGTGGCAGCGGCCAACCTTACACCAAAAGCGGAAGCTGCTCTCCGCCACAAACTAATCCTTACAATCGAGGCTGCTCTAAGATATATCGTTGTAGGTCGGATGATTGA ATGCCTTTACAATCTTGCTTTCTTCTCCTTCTCTTTCTCCTCCTTCTCCAACATCTTTGTCTCGTTCGAGCTTCATCGGCGCATTCTTGCAATGGCTCCATAGCCGAGTGTGGTAGCGAGGAAGAGATACTGATGGAGTCGGAGATAAGTCGAAGGTTTCTCGAACAACAAAAGAAATACATCTCCATTGGAGCTTTGAAGAAGGATCATCCAGCTTGCGATGGTGGTGGCAGCGGCCAACCTTACACCAAAAGCGGAAGCTGCTCTCCGCCACAAACTAATCCTTACAATCGAGGCTGCTCTAAGATATATCGTTGTAGGTCGGATGATTGA MPLQSCFLLLLFLLLLQHLCLVRASSAHSCNGSIAECGSEEEILMESEISRRFLEQQKKYISIGALKKDHPACDGGGSGQPYTKSGSCSPPQTNPYNRGCSKIYRCRSDD Homology
BLAST of Lsi05G013670 vs. ExPASy Swiss-Prot
Match: O23262 (Protein RALF-like 32 OS=Arabidopsis thaliana OX=3702 GN=RALFL32 PE=3 SV=1) HSP 1 Score: 90.1 bits (222), Expect = 1.7e-17 Identity = 51/107 (47.66%), Postives = 67/107 (62.62%), Query Frame = 0
BLAST of Lsi05G013670 vs. ExPASy Swiss-Prot
Match: Q945T0 (Rapid alkalinization factor OS=Nicotiana tabacum OX=4097 GN=RALF PE=1 SV=1) HSP 1 Score: 68.2 bits (165), Expect = 6.8e-11 Identity = 42/86 (48.84%), Postives = 50/86 (58.14%), Query Frame = 0
BLAST of Lsi05G013670 vs. ExPASy Swiss-Prot
Match: Q9MA62 (Protein RALF-like 22 OS=Arabidopsis thaliana OX=3702 GN=RALFL22 PE=3 SV=1) HSP 1 Score: 68.2 bits (165), Expect = 6.8e-11 Identity = 44/93 (47.31%), Postives = 56/93 (60.22%), Query Frame = 0
BLAST of Lsi05G013670 vs. ExPASy Swiss-Prot
Match: Q9SRY3 (Protein RALF-like 1 OS=Arabidopsis thaliana OX=3702 GN=RALF1 PE=1 SV=1) HSP 1 Score: 66.6 bits (161), Expect = 2.0e-10 Identity = 39/79 (49.37%), Postives = 50/79 (63.29%), Query Frame = 0
BLAST of Lsi05G013670 vs. ExPASy Swiss-Prot
Match: Q8L9P8 (Protein RALF-like 33 OS=Arabidopsis thaliana OX=3702 GN=RALFL33 PE=2 SV=1) HSP 1 Score: 65.9 bits (159), Expect = 3.4e-10 Identity = 39/81 (48.15%), Postives = 50/81 (61.73%), Query Frame = 0
BLAST of Lsi05G013670 vs. ExPASy TrEMBL
Match: A0A6J1GXB3 (protein RALF-like 32 OS=Cucurbita moschata OX=3662 GN=LOC111458002 PE=3 SV=1) HSP 1 Score: 188.7 bits (478), Expect = 1.3e-44 Identity = 93/107 (86.92%), Postives = 97/107 (90.65%), Query Frame = 0
BLAST of Lsi05G013670 vs. ExPASy TrEMBL
Match: A0A0A0L9A8 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G171840 PE=3 SV=1) HSP 1 Score: 184.5 bits (467), Expect = 2.4e-43 Identity = 92/112 (82.14%), Postives = 98/112 (87.50%), Query Frame = 0
BLAST of Lsi05G013670 vs. ExPASy TrEMBL
Match: A0A5A7VKE5 (Protein RALF-like 32 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold577G00040 PE=3 SV=1) HSP 1 Score: 183.7 bits (465), Expect = 4.1e-43 Identity = 93/114 (81.58%), Postives = 98/114 (85.96%), Query Frame = 0
BLAST of Lsi05G013670 vs. ExPASy TrEMBL
Match: A0A6J1C9Y4 (protein RALF-like 32 OS=Momordica charantia OX=3673 GN=LOC111009304 PE=3 SV=1) HSP 1 Score: 171.4 bits (433), Expect = 2.1e-39 Identity = 88/109 (80.73%), Postives = 94/109 (86.24%), Query Frame = 0
BLAST of Lsi05G013670 vs. ExPASy TrEMBL
Match: A0A0A0L624 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G171850 PE=3 SV=1) HSP 1 Score: 139.4 bits (350), Expect = 8.8e-30 Identity = 78/101 (77.23%), Postives = 82/101 (81.19%), Query Frame = 0
BLAST of Lsi05G013670 vs. NCBI nr
Match: XP_038900965.1 (protein RALF-like 32 [Benincasa hispida]) HSP 1 Score: 191.8 bits (486), Expect = 3.1e-45 Identity = 98/109 (89.91%), Postives = 99/109 (90.83%), Query Frame = 0
BLAST of Lsi05G013670 vs. NCBI nr
Match: XP_023528073.1 (protein RALF-like 32 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 191.0 bits (484), Expect = 5.3e-45 Identity = 94/107 (87.85%), Postives = 98/107 (91.59%), Query Frame = 0
BLAST of Lsi05G013670 vs. NCBI nr
Match: KAG6582127.1 (Protein RALF-like 32, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 189.9 bits (481), Expect = 1.2e-44 Identity = 94/107 (87.85%), Postives = 97/107 (90.65%), Query Frame = 0
BLAST of Lsi05G013670 vs. NCBI nr
Match: XP_022956250.1 (protein RALF-like 32 [Cucurbita moschata]) HSP 1 Score: 188.7 bits (478), Expect = 2.6e-44 Identity = 93/107 (86.92%), Postives = 97/107 (90.65%), Query Frame = 0
BLAST of Lsi05G013670 vs. NCBI nr
Match: KAG7018527.1 (Protein RALF-like 32, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 188.7 bits (478), Expect = 2.6e-44 Identity = 93/107 (86.92%), Postives = 97/107 (90.65%), Query Frame = 0
BLAST of Lsi05G013670 vs. TAIR 10
Match: AT4G14010.1 (ralf-like 32 ) HSP 1 Score: 90.1 bits (222), Expect = 1.2e-18 Identity = 51/107 (47.66%), Postives = 67/107 (62.62%), Query Frame = 0
BLAST of Lsi05G013670 vs. TAIR 10
Match: AT3G05490.1 (ralf-like 22 ) HSP 1 Score: 68.2 bits (165), Expect = 4.8e-12 Identity = 44/93 (47.31%), Postives = 56/93 (60.22%), Query Frame = 0
BLAST of Lsi05G013670 vs. TAIR 10
Match: AT1G02900.1 (rapid alkalinization factor 1 ) HSP 1 Score: 66.6 bits (161), Expect = 1.4e-11 Identity = 39/79 (49.37%), Postives = 50/79 (63.29%), Query Frame = 0
BLAST of Lsi05G013670 vs. TAIR 10
Match: AT4G15800.1 (ralf-like 33 ) HSP 1 Score: 65.9 bits (159), Expect = 2.4e-11 Identity = 39/81 (48.15%), Postives = 50/81 (61.73%), Query Frame = 0
BLAST of Lsi05G013670 vs. TAIR 10
Match: AT3G23805.1 (ralf-like 24 ) HSP 1 Score: 53.1 bits (126), Expect = 1.6e-07 Identity = 46/115 (40.00%), Postives = 57/115 (49.57%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bottle gourd (USVL1VR-Ls) v1
Date Performed: 2021-10-18
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|