Lsi04G006190 (gene) Bottle gourd (USVL1VR-Ls) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAAGGCTTCGATTTTTACCCAAAAACAGTGGTTCAAGTCAATGCTTGGGCAATTGGACGAGACCCCAAATGCTGGAAAGACCCAGAAGAGTTCATACCAGAGAGATTTGCAGAGAGCTGTGTTGATTACAGAGGACAGCATTTTGAGTTGCTGCCGTTTGGGGCTGGCCGGAGGATTTGTCCGGCGTTGAATATGGGAATCAAAATTGTGGAGTTTGCTTTGGCGAATCTTTTGTACCATTTTGATTGA ATGGAAGGCTTCGATTTTTACCCAAAAACAGTGGTTCAAGTCAATGCTTGGGCAATTGGACGAGACCCCAAATGCTGGAAAGACCCAGAAGAGTTCATACCAGAGAGATTTGCAGAGAGCTGTGTTGATTACAGAGGACAGCATTTTGAGTTGCTGCCGTTTGGGGCTGGCCGGAGGATTTGTCCGGCGTTGAATATGGGAATCAAAATTGTGGAGTTTGCTTTGGCGAATCTTTTGTACCATTTTGATTGA ATGGAAGGCTTCGATTTTTACCCAAAAACAGTGGTTCAAGTCAATGCTTGGGCAATTGGACGAGACCCCAAATGCTGGAAAGACCCAGAAGAGTTCATACCAGAGAGATTTGCAGAGAGCTGTGTTGATTACAGAGGACAGCATTTTGAGTTGCTGCCGTTTGGGGCTGGCCGGAGGATTTGTCCGGCGTTGAATATGGGAATCAAAATTGTGGAGTTTGCTTTGGCGAATCTTTTGTACCATTTTGATTGA MEGFDFYPKTVVQVNAWAIGRDPKCWKDPEEFIPERFAESCVDYRGQHFELLPFGAGRRICPALNMGIKIVEFALANLLYHFD Homology
BLAST of Lsi04G006190 vs. ExPASy Swiss-Prot
Match: O65788 (Cytochrome P450 71B2 OS=Arabidopsis thaliana OX=3702 GN=CYP71B2 PE=2 SV=2) HSP 1 Score: 132.5 bits (332), Expect = 2.2e-30 Identity = 56/83 (67.47%), Postives = 66/83 (79.52%), Query Frame = 0
BLAST of Lsi04G006190 vs. ExPASy Swiss-Prot
Match: Q9LVD2 (Cytochrome P450 71B10 OS=Arabidopsis thaliana OX=3702 GN=CYP71B10 PE=3 SV=1) HSP 1 Score: 131.0 bits (328), Expect = 6.4e-30 Identity = 55/83 (66.27%), Postives = 66/83 (79.52%), Query Frame = 0
BLAST of Lsi04G006190 vs. ExPASy Swiss-Prot
Match: Q9LTM6 (Cytochrome P450 71B17 OS=Arabidopsis thaliana OX=3702 GN=CYP71B17 PE=3 SV=1) HSP 1 Score: 130.2 bits (326), Expect = 1.1e-29 Identity = 56/83 (67.47%), Postives = 65/83 (78.31%), Query Frame = 0
BLAST of Lsi04G006190 vs. ExPASy Swiss-Prot
Match: O65787 (Cytochrome P450 71B6 OS=Arabidopsis thaliana OX=3702 GN=CYP71B6 PE=2 SV=1) HSP 1 Score: 127.5 bits (319), Expect = 7.1e-29 Identity = 53/83 (63.86%), Postives = 67/83 (80.72%), Query Frame = 0
BLAST of Lsi04G006190 vs. ExPASy Swiss-Prot
Match: Q9LIP5 (Cytochrome P450 71B35 OS=Arabidopsis thaliana OX=3702 GN=CYP71B35 PE=2 SV=1) HSP 1 Score: 127.1 bits (318), Expect = 9.3e-29 Identity = 54/83 (65.06%), Postives = 64/83 (77.11%), Query Frame = 0
BLAST of Lsi04G006190 vs. ExPASy TrEMBL
Match: A0A5D3CZQ9 (Cytochrome P450 71B19-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold35G001660 PE=3 SV=1) HSP 1 Score: 169.1 bits (427), Expect = 7.9e-39 Identity = 72/83 (86.75%), Postives = 78/83 (93.98%), Query Frame = 0
BLAST of Lsi04G006190 vs. ExPASy TrEMBL
Match: A0A1S3BF10 (cytochrome P450 71B19-like OS=Cucumis melo OX=3656 GN=LOC103488949 PE=3 SV=1) HSP 1 Score: 169.1 bits (427), Expect = 7.9e-39 Identity = 72/83 (86.75%), Postives = 78/83 (93.98%), Query Frame = 0
BLAST of Lsi04G006190 vs. ExPASy TrEMBL
Match: A0A0A0KVE8 (Cytochrome P450 OS=Cucumis sativus OX=3659 GN=Csa_5G593440 PE=3 SV=1) HSP 1 Score: 168.7 bits (426), Expect = 1.0e-38 Identity = 70/83 (84.34%), Postives = 80/83 (96.39%), Query Frame = 0
BLAST of Lsi04G006190 vs. ExPASy TrEMBL
Match: A0A6J1DE04 (cytochrome P450 71B34-like OS=Momordica charantia OX=3673 GN=LOC111019659 PE=3 SV=1) HSP 1 Score: 164.9 bits (416), Expect = 1.5e-37 Identity = 72/83 (86.75%), Postives = 76/83 (91.57%), Query Frame = 0
BLAST of Lsi04G006190 vs. ExPASy TrEMBL
Match: A0A6J1HTM5 (cytochrome P450 71B34-like OS=Cucurbita maxima OX=3661 GN=LOC111466488 PE=3 SV=1) HSP 1 Score: 160.6 bits (405), Expect = 2.8e-36 Identity = 66/83 (79.52%), Postives = 76/83 (91.57%), Query Frame = 0
BLAST of Lsi04G006190 vs. NCBI nr
Match: XP_038891462.1 (cytochrome P450 71B2-like [Benincasa hispida]) HSP 1 Score: 179.5 bits (454), Expect = 1.2e-41 Identity = 76/83 (91.57%), Postives = 81/83 (97.59%), Query Frame = 0
BLAST of Lsi04G006190 vs. NCBI nr
Match: XP_008446135.1 (PREDICTED: cytochrome P450 71B19-like [Cucumis melo] >KAA0034252.1 cytochrome P450 71B19-like [Cucumis melo var. makuwa] >TYK15669.1 cytochrome P450 71B19-like [Cucumis melo var. makuwa]) HSP 1 Score: 169.1 bits (427), Expect = 1.6e-38 Identity = 72/83 (86.75%), Postives = 78/83 (93.98%), Query Frame = 0
BLAST of Lsi04G006190 vs. NCBI nr
Match: XP_031741161.1 (cytochrome P450 71B19 isoform X1 [Cucumis sativus]) HSP 1 Score: 168.7 bits (426), Expect = 2.1e-38 Identity = 70/83 (84.34%), Postives = 80/83 (96.39%), Query Frame = 0
BLAST of Lsi04G006190 vs. NCBI nr
Match: XP_004135499.1 (cytochrome P450 71B19 isoform X2 [Cucumis sativus] >KAE8648692.1 hypothetical protein Csa_008772 [Cucumis sativus]) HSP 1 Score: 168.7 bits (426), Expect = 2.1e-38 Identity = 70/83 (84.34%), Postives = 80/83 (96.39%), Query Frame = 0
BLAST of Lsi04G006190 vs. NCBI nr
Match: XP_022151754.1 (cytochrome P450 71B34-like [Momordica charantia]) HSP 1 Score: 164.9 bits (416), Expect = 3.1e-37 Identity = 72/83 (86.75%), Postives = 76/83 (91.57%), Query Frame = 0
BLAST of Lsi04G006190 vs. TAIR 10
Match: AT1G13080.1 (cytochrome P450, family 71, subfamily B, polypeptide 2 ) HSP 1 Score: 132.5 bits (332), Expect = 1.6e-31 Identity = 56/83 (67.47%), Postives = 66/83 (79.52%), Query Frame = 0
BLAST of Lsi04G006190 vs. TAIR 10
Match: AT1G13080.2 (cytochrome P450, family 71, subfamily B, polypeptide 2 ) HSP 1 Score: 132.5 bits (332), Expect = 1.6e-31 Identity = 56/83 (67.47%), Postives = 66/83 (79.52%), Query Frame = 0
BLAST of Lsi04G006190 vs. TAIR 10
Match: AT5G57260.1 (cytochrome P450, family 71, subfamily B, polypeptide 10 ) HSP 1 Score: 131.0 bits (328), Expect = 4.6e-31 Identity = 55/83 (66.27%), Postives = 66/83 (79.52%), Query Frame = 0
BLAST of Lsi04G006190 vs. TAIR 10
Match: AT3G26160.1 (cytochrome P450, family 71, subfamily B, polypeptide 17 ) HSP 1 Score: 130.2 bits (326), Expect = 7.8e-31 Identity = 56/83 (67.47%), Postives = 65/83 (78.31%), Query Frame = 0
BLAST of Lsi04G006190 vs. TAIR 10
Match: AT2G24180.1 (cytochrome p450 71b6 ) HSP 1 Score: 127.5 bits (319), Expect = 5.0e-30 Identity = 53/83 (63.86%), Postives = 67/83 (80.72%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bottle gourd (USVL1VR-Ls) v1
Date Performed: 2021-10-18
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|