
Lsi04G004630 (gene) Bottle gourd (USVL1VR-Ls) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGCAGTCAAAAAAAGATATATCAGATGGTTCTGATTGCTGCACTTGGACTTTTATTCCTACTTTGATTGGTACTTATGAGCACGTTAAGAAATATCGCAAAGCACCCAACAATTGCTTTGATCGATTCCTTCATCACACTCAAAGAGCTCAAACAATATTCACACCCAATTGCTCAATAATGGCCTTTTCAATGATTGCCAACTTTTAGGCCAATTTGTTGCATCCATTGCCCTTAAAACCCCCACCAATCTAGTTTATTCTAATCAAATTTTGGACCAATGTGCCGACCCAACAATTCCATGATCAGAGCCTGTTCGAAAAGGTTAACCCCAACAAAAGCTTCCAGTTTTACAACAAAATTCTCCAATCCAATGATGTTATGTAACAGACAATTACACTTTCAATTTTCTGGTTCGCACTTGCGCCCAATTGTCTACTTGTGAAGCAGGTCTAACTGTTCATGGTGCACTTATCAAACATGGTTTTGAATTTGACCCAGATGTTCAAAGTGGGTTAATTTTTATGTATGCTGAAATGGGTTGTTTCATGTTATCGTGTGTTTGAATCAGTTGAAGTTAGATATAATTTGTCAGACGGCCATAGTGAGTGCTTGTGCAAAATGTGGTGATACTGATTTTGCACGAGAGCTGTTCGACGTAATGCTTCAAAGGGATTCTGTGTCATGGAATGCTATGATTGCTGGTTATGCACAGAGGGGCAATCAAGGGAAGCTTTGA ATGCAGTCAAAAAAAGATATATCAGATGGTTCTGATTGCTGCACTTGGACTTTTATTCCTACTTTGATTGACAATTACACTTTCAATTTTCTGGTTCGCACTTGCGCCCAATTGTCTACTTGTGAAGCAGGTCTAACTGTTCATGGTGCACTTATCAAACATGGTTTTGAATTTGACCCAGATGTTCAAAATATAATTTGTCAGACGGCCATAGTGAGTGCTTGTGCAAAATGTGGTGATACTGATTTTGCACGAGAGCTGTTCGACGTAATGCTTCAAAGGGATTCTGTGTCATGGAATGCTATGATTGCTGGTTATGCACAGAGGGGCAATCAAGGGAAGCTTTGA ATGCAGTCAAAAAAAGATATATCAGATGGTTCTGATTGCTGCACTTGGACTTTTATTCCTACTTTGATTGACAATTACACTTTCAATTTTCTGGTTCGCACTTGCGCCCAATTGTCTACTTGTGAAGCAGGTCTAACTGTTCATGGTGCACTTATCAAACATGGTTTTGAATTTGACCCAGATGTTCAAAATATAATTTGTCAGACGGCCATAGTGAGTGCTTGTGCAAAATGTGGTGATACTGATTTTGCACGAGAGCTGTTCGACGTAATGCTTCAAAGGGATTCTGTGTCATGGAATGCTATGATTGCTGGTTATGCACAGAGGGGCAATCAAGGGAAGCTTTGA MQSKKDISDGSDCCTWTFIPTLIDNYTFNFLVRTCAQLSTCEAGLTVHGALIKHGFEFDPDVQNIICQTAIVSACAKCGDTDFARELFDVMLQRDSVSWNAMIAGYAQRGNQGKL Homology
BLAST of Lsi04G004630 vs. ExPASy Swiss-Prot
Match: Q9FND7 (Putative pentatricopeptide repeat-containing protein At5g40405 OS=Arabidopsis thaliana OX=3702 GN=PCMP-H14 PE=3 SV=1) HSP 1 Score: 102.4 bits (254), Expect = 3.4e-21 Identity = 51/113 (45.13%), Postives = 66/113 (58.41%), Query Frame = 0
BLAST of Lsi04G004630 vs. ExPASy Swiss-Prot
Match: O64705 (Pentatricopeptide repeat-containing protein At2g34400 OS=Arabidopsis thaliana OX=3702 GN=PCMP-E23 PE=3 SV=2) HSP 1 Score: 79.3 bits (194), Expect = 3.1e-14 Identity = 35/87 (40.23%), Postives = 55/87 (63.22%), Query Frame = 0
BLAST of Lsi04G004630 vs. ExPASy Swiss-Prot
Match: Q9M9E2 (Pentatricopeptide repeat-containing protein At1g15510, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PCMP-H73 PE=1 SV=1) HSP 1 Score: 78.6 bits (192), Expect = 5.2e-14 Identity = 38/87 (43.68%), Postives = 53/87 (60.92%), Query Frame = 0
BLAST of Lsi04G004630 vs. ExPASy Swiss-Prot
Match: Q9LUJ2 (Pentatricopeptide repeat-containing protein At3g22690 OS=Arabidopsis thaliana OX=3702 GN=PCMP-H56 PE=3 SV=1) HSP 1 Score: 73.9 bits (180), Expect = 1.3e-12 Identity = 36/86 (41.86%), Postives = 53/86 (61.63%), Query Frame = 0
BLAST of Lsi04G004630 vs. ExPASy Swiss-Prot
Match: Q9LXF2 (Pentatricopeptide repeat-containing protein At5g15300 OS=Arabidopsis thaliana OX=3702 GN=PCMP-E40 PE=2 SV=2) HSP 1 Score: 73.6 bits (179), Expect = 1.7e-12 Identity = 33/87 (37.93%), Postives = 51/87 (58.62%), Query Frame = 0
BLAST of Lsi04G004630 vs. ExPASy TrEMBL
Match: A0A6J1DA54 (putative pentatricopeptide repeat-containing protein At5g40405 OS=Momordica charantia OX=3673 GN=LOC111019070 PE=3 SV=1) HSP 1 Score: 151.8 bits (382), Expect = 1.8e-33 Identity = 75/113 (66.37%), Postives = 81/113 (71.68%), Query Frame = 0
BLAST of Lsi04G004630 vs. ExPASy TrEMBL
Match: A0A6J1HYM9 (putative pentatricopeptide repeat-containing protein At5g40405 OS=Cucurbita maxima OX=3661 GN=LOC111467805 PE=3 SV=1) HSP 1 Score: 149.1 bits (375), Expect = 1.2e-32 Identity = 74/113 (65.49%), Postives = 80/113 (70.80%), Query Frame = 0
BLAST of Lsi04G004630 vs. ExPASy TrEMBL
Match: A0A6J1FZH3 (putative pentatricopeptide repeat-containing protein At5g40405 OS=Cucurbita moschata OX=3662 GN=LOC111449343 PE=3 SV=1) HSP 1 Score: 147.1 bits (370), Expect = 4.4e-32 Identity = 72/113 (63.72%), Postives = 79/113 (69.91%), Query Frame = 0
BLAST of Lsi04G004630 vs. ExPASy TrEMBL
Match: A0A5A7SZ47 (Putative pentatricopeptide repeat-containing protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold35G00320 PE=3 SV=1) HSP 1 Score: 134.8 bits (338), Expect = 2.3e-28 Identity = 69/113 (61.06%), Postives = 75/113 (66.37%), Query Frame = 0
BLAST of Lsi04G004630 vs. ExPASy TrEMBL
Match: A0A5N6R2U6 (DYW_deaminase domain-containing protein OS=Carpinus fangiana OX=176857 GN=FH972_009040 PE=3 SV=1) HSP 1 Score: 134.8 bits (338), Expect = 2.3e-28 Identity = 68/117 (58.12%), Postives = 76/117 (64.96%), Query Frame = 0
BLAST of Lsi04G004630 vs. NCBI nr
Match: XP_038891785.1 (putative pentatricopeptide repeat-containing protein At5g40405 [Benincasa hispida]) HSP 1 Score: 155.6 bits (392), Expect = 2.6e-34 Identity = 78/113 (69.03%), Postives = 81/113 (71.68%), Query Frame = 0
BLAST of Lsi04G004630 vs. NCBI nr
Match: XP_022151045.1 (putative pentatricopeptide repeat-containing protein At5g40405 [Momordica charantia]) HSP 1 Score: 151.8 bits (382), Expect = 3.7e-33 Identity = 75/113 (66.37%), Postives = 81/113 (71.68%), Query Frame = 0
BLAST of Lsi04G004630 vs. NCBI nr
Match: XP_022968643.1 (putative pentatricopeptide repeat-containing protein At5g40405 [Cucurbita maxima]) HSP 1 Score: 149.1 bits (375), Expect = 2.4e-32 Identity = 74/113 (65.49%), Postives = 80/113 (70.80%), Query Frame = 0
BLAST of Lsi04G004630 vs. NCBI nr
Match: XP_023542265.1 (putative pentatricopeptide repeat-containing protein At5g40405 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 149.1 bits (375), Expect = 2.4e-32 Identity = 74/113 (65.49%), Postives = 80/113 (70.80%), Query Frame = 0
BLAST of Lsi04G004630 vs. NCBI nr
Match: KAG6574109.1 (putative pentatricopeptide repeat-containing protein, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 147.5 bits (371), Expect = 7.0e-32 Identity = 73/113 (64.60%), Postives = 79/113 (69.91%), Query Frame = 0
BLAST of Lsi04G004630 vs. TAIR 10
Match: AT5G40405.1 (Tetratricopeptide repeat (TPR)-like superfamily protein ) HSP 1 Score: 102.4 bits (254), Expect = 2.4e-22 Identity = 51/113 (45.13%), Postives = 66/113 (58.41%), Query Frame = 0
BLAST of Lsi04G004630 vs. TAIR 10
Match: AT2G34400.1 (Pentatricopeptide repeat (PPR-like) superfamily protein ) HSP 1 Score: 79.3 bits (194), Expect = 2.2e-15 Identity = 35/87 (40.23%), Postives = 55/87 (63.22%), Query Frame = 0
BLAST of Lsi04G004630 vs. TAIR 10
Match: AT1G15510.1 (Tetratricopeptide repeat (TPR)-like superfamily protein ) HSP 1 Score: 78.6 bits (192), Expect = 3.7e-15 Identity = 38/87 (43.68%), Postives = 53/87 (60.92%), Query Frame = 0
BLAST of Lsi04G004630 vs. TAIR 10
Match: AT3G22690.1 (CONTAINS InterPro DOMAIN/s: Protein of unknown function DUF1685 (InterPro:IPR012881), Pentatricopeptide repeat (InterPro:IPR002885); BEST Arabidopsis thaliana protein match is: Tetratricopeptide repeat (TPR)-like superfamily protein (TAIR:AT2G29760.1); Has 49784 Blast hits to 14716 proteins in 280 species: Archae - 2; Bacteria - 10; Metazoa - 107; Fungi - 167; Plants - 48594; Viruses - 0; Other Eukaryotes - 904 (source: NCBI BLink). ) HSP 1 Score: 73.9 bits (180), Expect = 9.2e-14 Identity = 36/86 (41.86%), Postives = 53/86 (61.63%), Query Frame = 0
BLAST of Lsi04G004630 vs. TAIR 10
Match: AT3G22690.2 (INVOLVED IN: photosystem II assembly, regulation of chlorophyll biosynthetic process, photosystem I assembly, thylakoid membrane organization, RNA modification; LOCATED IN: chloroplast; EXPRESSED IN: 13 plant structures; EXPRESSED DURING: LP.04 four leaves visible, 4 anthesis, petal differentiation and expansion stage, E expanded cotyledon stage, D bilateral stage; CONTAINS InterPro DOMAIN/s: Pentatricopeptide repeat (InterPro:IPR002885); BEST Arabidopsis thaliana protein match is: Tetratricopeptide repeat (TPR)-like superfamily protein (TAIR:AT2G29760.1). ) HSP 1 Score: 73.9 bits (180), Expect = 9.2e-14 Identity = 36/86 (41.86%), Postives = 53/86 (61.63%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bottle gourd (USVL1VR-Ls) v1
Date Performed: 2021-10-18
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|