Lsi02G027070 (gene) Bottle gourd (USVL1VR-Ls) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGACGACAAGTCCGGTGACGATGAGACTCAACGACACAGGCATGAATTACTTTGTTTGCACTGTCGGCGCACATTGTTCGTCAGGTCAAAAGTTATCCATCAATGTCGTGGCCGCCACGGCTGGTGGTCCGATGTCGCCGACTTCACCCGGACCACCTTCTTCCTCACTACTACCGCCGCCTCGTTCCTCCTCCAATGCACTTACGGCAACCCTTTATCTCACTTTCTCCGCTCTTCTTATGGCCTTCTTTTAG ATGACGACAAGTCCGGTGACGATGAGACTCAACGACACAGGCATGAATTACTTTGTTTGCACTGTCGGCGCACATTGTTCGTCAGGTCAAAAGTTATCCATCAATGTCGTGGCCGCCACGGCTGGTGGTCCGATGTCGCCGACTTCACCCGGACCACCTTCTTCCTCACTACTACCGCCGCCTCGTTCCTCCTCCAATGCACTTACGGCAACCCTTTATCTCACTTTCTCCGCTCTTCTTATGGCCTTCTTTTAG ATGACGACAAGTCCGGTGACGATGAGACTCAACGACACAGGCATGAATTACTTTGTTTGCACTGTCGGCGCACATTGTTCGTCAGGTCAAAAGTTATCCATCAATGTCGTGGCCGCCACGGCTGGTGGTCCGATGTCGCCGACTTCACCCGGACCACCTTCTTCCTCACTACTACCGCCGCCTCGTTCCTCCTCCAATGCACTTACGGCAACCCTTTATCTCACTTTCTCCGCTCTTCTTATGGCCTTCTTTTAG MTTSPVTMRLNDTGMNYFVCTVGAHCSSGQKLSINVVAATAGGPMSPTSPGPPSSSLLPPPRSSSNALTATLYLTFSALLMAFF Homology
BLAST of Lsi02G027070 vs. ExPASy Swiss-Prot
Match: P29602 (Cucumber peeling cupredoxin OS=Cucumis sativus OX=3659 PE=1 SV=3) HSP 1 Score: 74.7 bits (182), Expect = 5.5e-13 Identity = 40/59 (67.80%), Postives = 46/59 (77.97%), Query Frame = 0
BLAST of Lsi02G027070 vs. ExPASy Swiss-Prot
Match: P42849 (Umecyanin OS=Armoracia rusticana OX=3704 PE=1 SV=1) HSP 1 Score: 57.0 bits (136), Expect = 1.2e-07 Identity = 30/48 (62.50%), Postives = 34/48 (70.83%), Query Frame = 0
BLAST of Lsi02G027070 vs. ExPASy Swiss-Prot
Match: Q07488 (Blue copper protein OS=Arabidopsis thaliana OX=3702 GN=BCB PE=2 SV=2) HSP 1 Score: 56.6 bits (135), Expect = 1.6e-07 Identity = 31/59 (52.54%), Postives = 36/59 (61.02%), Query Frame = 0
BLAST of Lsi02G027070 vs. ExPASy Swiss-Prot
Match: O80517 (Uclacyanin-2 OS=Arabidopsis thaliana OX=3702 GN=At2g44790 PE=2 SV=1) HSP 1 Score: 48.1 bits (113), Expect = 5.5e-05 Identity = 28/68 (41.18%), Postives = 39/68 (57.35%), Query Frame = 0
BLAST of Lsi02G027070 vs. ExPASy TrEMBL
Match: A0A5D3CF84 (Cucumber peeling cupredoxin-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold459G001960 PE=4 SV=1) HSP 1 Score: 102.4 bits (254), Expect = 9.1e-19 Identity = 61/89 (68.54%), Postives = 68/89 (76.40%), Query Frame = 0
BLAST of Lsi02G027070 vs. ExPASy TrEMBL
Match: A0A5A7UZ00 (Cucumber peeling cupredoxin-like OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold339G002210 PE=4 SV=1) HSP 1 Score: 102.4 bits (254), Expect = 9.1e-19 Identity = 61/89 (68.54%), Postives = 68/89 (76.40%), Query Frame = 0
BLAST of Lsi02G027070 vs. ExPASy TrEMBL
Match: A0A1S3CDJ1 (cucumber peeling cupredoxin-like OS=Cucumis melo OX=3656 GN=LOC103499805 PE=4 SV=1) HSP 1 Score: 102.4 bits (254), Expect = 9.1e-19 Identity = 61/89 (68.54%), Postives = 68/89 (76.40%), Query Frame = 0
BLAST of Lsi02G027070 vs. ExPASy TrEMBL
Match: Q96403 (Stellacyanin OS=Cucumis sativus OX=3659 GN=Csa_7G432470 PE=2 SV=1) HSP 1 Score: 99.0 bits (245), Expect = 1.0e-17 Identity = 62/88 (70.45%), Postives = 68/88 (77.27%), Query Frame = 0
BLAST of Lsi02G027070 vs. ExPASy TrEMBL
Match: A0A6J1GPD3 (cucumber peeling cupredoxin-like OS=Cucurbita moschata OX=3662 GN=LOC111456235 PE=4 SV=1) HSP 1 Score: 99.0 bits (245), Expect = 1.0e-17 Identity = 53/84 (63.10%), Postives = 63/84 (75.00%), Query Frame = 0
BLAST of Lsi02G027070 vs. NCBI nr
Match: XP_038896386.1 (cucumber peeling cupredoxin-like [Benincasa hispida]) HSP 1 Score: 112.5 bits (280), Expect = 1.8e-21 Identity = 58/80 (72.50%), Postives = 68/80 (85.00%), Query Frame = 0
BLAST of Lsi02G027070 vs. NCBI nr
Match: XP_008461124.1 (PREDICTED: cucumber peeling cupredoxin-like [Cucumis melo] >TYK10543.1 cucumber peeling cupredoxin-like [Cucumis melo var. makuwa]) HSP 1 Score: 102.4 bits (254), Expect = 1.9e-18 Identity = 61/89 (68.54%), Postives = 68/89 (76.40%), Query Frame = 0
BLAST of Lsi02G027070 vs. NCBI nr
Match: KAA0058749.1 (cucumber peeling cupredoxin-like [Cucumis melo var. makuwa]) HSP 1 Score: 102.4 bits (254), Expect = 1.9e-18 Identity = 61/89 (68.54%), Postives = 68/89 (76.40%), Query Frame = 0
BLAST of Lsi02G027070 vs. NCBI nr
Match: KAG6575597.1 (hypothetical protein SDJN03_26236, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 100.5 bits (249), Expect = 7.2e-18 Identity = 54/84 (64.29%), Postives = 64/84 (76.19%), Query Frame = 0
BLAST of Lsi02G027070 vs. NCBI nr
Match: XP_023547709.1 (cucumber peeling cupredoxin-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 100.1 bits (248), Expect = 9.4e-18 Identity = 54/84 (64.29%), Postives = 64/84 (76.19%), Query Frame = 0
BLAST of Lsi02G027070 vs. TAIR 10
Match: AT5G20230.1 (blue-copper-binding protein ) HSP 1 Score: 56.6 bits (135), Expect = 1.1e-08 Identity = 31/59 (52.54%), Postives = 36/59 (61.02%), Query Frame = 0
BLAST of Lsi02G027070 vs. TAIR 10
Match: AT2G44790.1 (uclacyanin 2 ) HSP 1 Score: 48.1 bits (113), Expect = 3.9e-06 Identity = 28/68 (41.18%), Postives = 39/68 (57.35%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bottle gourd (USVL1VR-Ls) v1
Date Performed: 2021-10-18
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|