![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
Lsi02G001030 (gene) Bottle gourd (USVL1VR-Ls) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCAACTCCATCTAGGTCTGAGATCCTCTCGCTCTTTCGTTCTCTCCTGCGAACGGCGCGTCAATTTCCCGATTACAACATCAGAGAATACACCAAACGCCGCACCATTGATGCCTTCCGAGAAAATCAGAGCCTCTCCGACGCTTCATCCATCTCCTCCGCCTACGCCGGCGGAAAAGCTCAGCTCGAGGTTGCGAAGCGGCAGGGCCTTGTTTACTCTCTTTACGCGCCTAAGGTCAAGAGTATCATGGATGTCGACCTTTGA ATGGCAACTCCATCTAGGTCTGAGATCCTCTCGCTCTTTCGTTCTCTCCTGCGAACGGCGCGTCAATTTCCCGATTACAACATCAGAGAATACACCAAACGCCGCACCATTGATGCCTTCCGAGAAAATCAGAGCCTCTCCGACGCTTCATCCATCTCCTCCGCCTACGCCGGCGGAAAAGCTCAGCTCGAGGTTGCGAAGCGGCAGGGCCTTGTTTACTCTCTTTACGCGCCTAAGGTCAAGAGTATCATGGATGTCGACCTTTGA ATGGCAACTCCATCTAGGTCTGAGATCCTCTCGCTCTTTCGTTCTCTCCTGCGAACGGCGCGTCAATTTCCCGATTACAACATCAGAGAATACACCAAACGCCGCACCATTGATGCCTTCCGAGAAAATCAGAGCCTCTCCGACGCTTCATCCATCTCCTCCGCCTACGCCGGCGGAAAAGCTCAGCTCGAGGTTGCGAAGCGGCAGGGCCTTGTTTACTCTCTTTACGCGCCTAAGGTCAAGAGTATCATGGATGTCGACCTTTGA MATPSRSEILSLFRSLLRTARQFPDYNIREYTKRRTIDAFRENQSLSDASSISSAYAGGKAQLEVAKRQGLVYSLYAPKVKSIMDVDL Homology
BLAST of Lsi02G001030 vs. ExPASy Swiss-Prot
Match: B5FZA8 (LYR motif-containing protein 4 OS=Taeniopygia guttata OX=59729 GN=LYRM4 PE=3 SV=1) HSP 1 Score: 68.6 bits (166), Expect = 4.1e-11 Identity = 35/77 (45.45%), Postives = 51/77 (66.23%), Query Frame = 0
BLAST of Lsi02G001030 vs. ExPASy Swiss-Prot
Match: Q9HD34 (LYR motif-containing protein 4 OS=Homo sapiens OX=9606 GN=LYRM4 PE=1 SV=1) HSP 1 Score: 59.3 bits (142), Expect = 2.5e-08 Identity = 32/77 (41.56%), Postives = 48/77 (62.34%), Query Frame = 0
BLAST of Lsi02G001030 vs. ExPASy Swiss-Prot
Match: Q8K215 (LYR motif-containing protein 4 OS=Mus musculus OX=10090 GN=Lyrm4 PE=1 SV=1) HSP 1 Score: 58.5 bits (140), Expect = 4.3e-08 Identity = 30/77 (38.96%), Postives = 47/77 (61.04%), Query Frame = 0
BLAST of Lsi02G001030 vs. ExPASy Swiss-Prot
Match: B5XD90 (LYR motif-containing protein 4B OS=Salmo salar OX=8030 GN=lyrm4b PE=3 SV=1) HSP 1 Score: 56.2 bits (134), Expect = 2.1e-07 Identity = 28/79 (35.44%), Postives = 48/79 (60.76%), Query Frame = 0
BLAST of Lsi02G001030 vs. ExPASy Swiss-Prot
Match: Q0VCG0 (LYR motif-containing protein 4 OS=Bos taurus OX=9913 GN=LYRM4 PE=3 SV=1) HSP 1 Score: 55.8 bits (133), Expect = 2.8e-07 Identity = 29/77 (37.66%), Postives = 47/77 (61.04%), Query Frame = 0
BLAST of Lsi02G001030 vs. ExPASy TrEMBL
Match: A0A6J1C8A4 (LYR motif-containing protein 4 OS=Momordica charantia OX=3673 GN=LOC111008892 PE=4 SV=1) HSP 1 Score: 152.9 bits (385), Expect = 6.2e-34 Identity = 82/88 (93.18%), Postives = 83/88 (94.32%), Query Frame = 0
BLAST of Lsi02G001030 vs. ExPASy TrEMBL
Match: A0A0A0LST7 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G039010 PE=4 SV=1) HSP 1 Score: 150.6 bits (379), Expect = 3.1e-33 Identity = 78/87 (89.66%), Postives = 83/87 (95.40%), Query Frame = 0
BLAST of Lsi02G001030 vs. ExPASy TrEMBL
Match: A0A251UU63 (Putative complex 1 LYR protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr05g0157171 PE=4 SV=1) HSP 1 Score: 136.0 bits (341), Expect = 7.8e-29 Identity = 67/86 (77.91%), Postives = 82/86 (95.35%), Query Frame = 0
BLAST of Lsi02G001030 vs. ExPASy TrEMBL
Match: A0A2J6KBZ0 (Uncharacterized protein OS=Lactuca sativa OX=4236 GN=LSAT_5X22101 PE=4 SV=1) HSP 1 Score: 132.5 bits (332), Expect = 8.6e-28 Identity = 64/84 (76.19%), Postives = 80/84 (95.24%), Query Frame = 0
BLAST of Lsi02G001030 vs. ExPASy TrEMBL
Match: A0A1S3XFP4 (LYR motif-containing protein 4 OS=Nicotiana tabacum OX=4097 GN=LOC107764517 PE=4 SV=1) HSP 1 Score: 132.1 bits (331), Expect = 1.1e-27 Identity = 63/87 (72.41%), Postives = 80/87 (91.95%), Query Frame = 0
BLAST of Lsi02G001030 vs. NCBI nr
Match: XP_038894896.1 (LYR motif-containing protein 4 [Benincasa hispida]) HSP 1 Score: 161.8 bits (408), Expect = 2.7e-36 Identity = 85/88 (96.59%), Postives = 87/88 (98.86%), Query Frame = 0
BLAST of Lsi02G001030 vs. NCBI nr
Match: KAG6607477.1 (LYR motif-containing protein 4, partial [Cucurbita argyrosperma subsp. sororia] >KAG7037133.1 LYR motif-containing protein 4, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 154.5 bits (389), Expect = 4.4e-34 Identity = 81/87 (93.10%), Postives = 83/87 (95.40%), Query Frame = 0
BLAST of Lsi02G001030 vs. NCBI nr
Match: XP_022137452.1 (LYR motif-containing protein 4 [Momordica charantia]) HSP 1 Score: 152.9 bits (385), Expect = 1.3e-33 Identity = 82/88 (93.18%), Postives = 83/88 (94.32%), Query Frame = 0
BLAST of Lsi02G001030 vs. NCBI nr
Match: KGN64034.1 (hypothetical protein Csa_014098 [Cucumis sativus]) HSP 1 Score: 150.6 bits (379), Expect = 6.3e-33 Identity = 78/87 (89.66%), Postives = 83/87 (95.40%), Query Frame = 0
BLAST of Lsi02G001030 vs. NCBI nr
Match: KAF5807263.1 (putative complex 1 LYR protein [Helianthus annuus]) HSP 1 Score: 136.0 bits (341), Expect = 1.6e-28 Identity = 67/86 (77.91%), Postives = 82/86 (95.35%), Query Frame = 0
BLAST of Lsi02G001030 vs. TAIR 10
Match: AT5G61220.1 (LYR family of Fe/S cluster biogenesis protein ) HSP 1 Score: 97.4 bits (241), Expect = 5.9e-21 Identity = 51/84 (60.71%), Postives = 63/84 (75.00%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bottle gourd (USVL1VR-Ls) v1
Date Performed: 2021-10-18
Relationships
The following mRNA feature(s) are a part of this gene:
|