Lsi01G020410 (gene) Bottle gourd (USVL1VR-Ls) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTTTGAATGACACTTTCTACGTATCCCATGGATCTCCCACCCTAACCATCGACGACACCATCAAAGCAAGACATTTCTTCCAATCTTGGAAGGAGAAGGTTTTCCCCCAAAGACCTAAAGCCATCCTCTGCATTTCTGCCCATTACGACACCGCCTACCCTATGGTCAATGTCGTTTCAGGCCTCAACGACACCATCTACGACTTCTATGGCTTCCCTTCGGAAATGTACAAGGTAACCATGTAG ATGGCTTTGAATGACACTTTCTACGTATCCCATGGATCTCCCACCCTAACCATCGACGACACCATCAAAGCAAGACATTTCTTCCAATCTTGGAAGGAGAAGGTTTTCCCCCAAAGACCTAAAGCCATCCTCTGCATTTCTGCCCATTACGACACCGCCTACCCTATGGTCAATGTCGTTTCAGGCCTCAACGACACCATCTACGACTTCTATGGCTTCCCTTCGGAAATGTACAAGGTAACCATGTAG ATGGCTTTGAATGACACTTTCTACGTATCCCATGGATCTCCCACCCTAACCATCGACGACACCATCAAAGCAAGACATTTCTTCCAATCTTGGAAGGAGAAGGTTTTCCCCCAAAGACCTAAAGCCATCCTCTGCATTTCTGCCCATTACGACACCGCCTACCCTATGGTCAATGTCGTTTCAGGCCTCAACGACACCATCTACGACTTCTATGGCTTCCCTTCGGAAATGTACAAGGTAACCATGTAG MALNDTFYVSHGSPTLTIDDTIKARHFFQSWKEKVFPQRPKAILCISAHYDTAYPMVNVVSGLNDTIYDFYGFPSEMYKVTM Homology
BLAST of Lsi01G020410 vs. ExPASy Swiss-Prot
Match: Q949R4 (Extradiol ring-cleavage dioxygenase OS=Arabidopsis thaliana OX=3702 GN=LIGB PE=2 SV=1) HSP 1 Score: 108.2 bits (269), Expect = 4.4e-23 Identity = 48/78 (61.54%), Postives = 64/78 (82.05%), Query Frame = 0
BLAST of Lsi01G020410 vs. ExPASy Swiss-Prot
Match: Q70FG7 (4,5-DOPA dioxygenase extradiol OS=Beta vulgaris OX=161934 GN=DODA PE=1 SV=1) HSP 1 Score: 98.6 bits (244), Expect = 3.5e-20 Identity = 41/77 (53.25%), Postives = 61/77 (79.22%), Query Frame = 0
BLAST of Lsi01G020410 vs. ExPASy Swiss-Prot
Match: I3PFJ9 (4,5-DOPA dioxygenase extradiol 1 OS=Beta vulgaris OX=161934 GN=DODA1 PE=2 SV=1) HSP 1 Score: 90.9 bits (224), Expect = 7.3e-18 Identity = 37/77 (48.05%), Postives = 59/77 (76.62%), Query Frame = 0
BLAST of Lsi01G020410 vs. ExPASy Swiss-Prot
Match: I3PFJ3 (4,5-DOPA dioxygenase extradiol 1 OS=Beta vulgaris OX=161934 GN=DODA1 PE=2 SV=1) HSP 1 Score: 90.1 bits (222), Expect = 1.2e-17 Identity = 37/76 (48.68%), Postives = 58/76 (76.32%), Query Frame = 0
BLAST of Lsi01G020410 vs. ExPASy Swiss-Prot
Match: B6F0W8 (4,5-DOPA dioxygenase extradiol OS=Mirabilis jalapa OX=3538 GN=DOD PE=1 SV=1) HSP 1 Score: 75.9 bits (185), Expect = 2.4e-13 Identity = 33/78 (42.31%), Postives = 50/78 (64.10%), Query Frame = 0
BLAST of Lsi01G020410 vs. ExPASy TrEMBL
Match: A0A6J1HS49 (extradiol ring-cleavage dioxygenase-like OS=Cucurbita maxima OX=3661 GN=LOC111467292 PE=3 SV=1) HSP 1 Score: 151.0 bits (380), Expect = 2.2e-33 Identity = 68/80 (85.00%), Postives = 74/80 (92.50%), Query Frame = 0
BLAST of Lsi01G020410 vs. ExPASy TrEMBL
Match: A0A6J1F3T4 (extradiol ring-cleavage dioxygenase-like OS=Cucurbita moschata OX=3662 GN=LOC111439883 PE=3 SV=1) HSP 1 Score: 149.4 bits (376), Expect = 6.4e-33 Identity = 67/80 (83.75%), Postives = 73/80 (91.25%), Query Frame = 0
BLAST of Lsi01G020410 vs. ExPASy TrEMBL
Match: A0A6J1D7R1 (extradiol ring-cleavage dioxygenase OS=Momordica charantia OX=3673 GN=LOC111017797 PE=3 SV=1) HSP 1 Score: 148.3 bits (373), Expect = 1.4e-32 Identity = 64/80 (80.00%), Postives = 76/80 (95.00%), Query Frame = 0
BLAST of Lsi01G020410 vs. ExPASy TrEMBL
Match: A0A6J1HWD7 (extradiol ring-cleavage dioxygenase-like OS=Cucurbita maxima OX=3661 GN=LOC111467255 PE=3 SV=1) HSP 1 Score: 141.0 bits (354), Expect = 2.3e-30 Identity = 63/80 (78.75%), Postives = 71/80 (88.75%), Query Frame = 0
BLAST of Lsi01G020410 vs. ExPASy TrEMBL
Match: A0A6J1EYV3 (extradiol ring-cleavage dioxygenase-like OS=Cucurbita moschata OX=3662 GN=LOC111439882 PE=3 SV=1) HSP 1 Score: 138.7 bits (348), Expect = 1.1e-29 Identity = 62/80 (77.50%), Postives = 70/80 (87.50%), Query Frame = 0
BLAST of Lsi01G020410 vs. NCBI nr
Match: XP_038883407.1 (extradiol ring-cleavage dioxygenase-like [Benincasa hispida]) HSP 1 Score: 158.3 bits (399), Expect = 2.8e-35 Identity = 71/80 (88.75%), Postives = 76/80 (95.00%), Query Frame = 0
BLAST of Lsi01G020410 vs. NCBI nr
Match: KAG6603159.1 (Extradiol ring-cleavage dioxygenase, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 151.0 bits (380), Expect = 4.5e-33 Identity = 68/80 (85.00%), Postives = 74/80 (92.50%), Query Frame = 0
BLAST of Lsi01G020410 vs. NCBI nr
Match: KAG7033478.1 (Extradiol ring-cleavage dioxygenase, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 151.0 bits (380), Expect = 4.5e-33 Identity = 68/80 (85.00%), Postives = 74/80 (92.50%), Query Frame = 0
BLAST of Lsi01G020410 vs. NCBI nr
Match: XP_022967922.1 (extradiol ring-cleavage dioxygenase-like [Cucurbita maxima]) HSP 1 Score: 151.0 bits (380), Expect = 4.5e-33 Identity = 68/80 (85.00%), Postives = 74/80 (92.50%), Query Frame = 0
BLAST of Lsi01G020410 vs. NCBI nr
Match: XP_022933118.1 (extradiol ring-cleavage dioxygenase-like [Cucurbita moschata]) HSP 1 Score: 149.4 bits (376), Expect = 1.3e-32 Identity = 67/80 (83.75%), Postives = 73/80 (91.25%), Query Frame = 0
BLAST of Lsi01G020410 vs. TAIR 10
Match: AT4G15093.1 (catalytic LigB subunit of aromatic ring-opening dioxygenase family ) HSP 1 Score: 108.2 bits (269), Expect = 3.1e-24 Identity = 48/78 (61.54%), Postives = 64/78 (82.05%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bottle gourd (USVL1VR-Ls) v1
Date Performed: 2021-10-18
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|