Lsi01G020170 (gene) Bottle gourd (USVL1VR-Ls) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGTATAGTATGGGAGGTCTTGCTGAATATTGTGTCACTCCAGCGCATGGAGTGTCAATTTTACCAAAATCGTTACCATACACAGAGTCGGCAATTCTAGGATGTGCAGTTTTTACTGCATATGGTGCCATGGCCCATGCTGCTGAAGTGCGCCCTGGGGATTCTGTTGCTATTATTGGAATTGGAGGTGTTGGTTCAAGGTAA ATGTATAGTATGGGAGGTCTTGCTGAATATTGTGTCACTCCAGCGCATGGAGTGTCAATTTTACCAAAATCGTTACCATACACAGAGTCGGCAATTCTAGGATGTGCAGTTTTTACTGCATATGGTGCCATGGCCCATGCTGCTGAAGTGCGCCCTGGGGATTCTGTTGCTATTATTGGAATTGGAGGTGTTGGTTCAAGGTAA ATGTATAGTATGGGAGGTCTTGCTGAATATTGTGTCACTCCAGCGCATGGAGTGTCAATTTTACCAAAATCGTTACCATACACAGAGTCGGCAATTCTAGGATGTGCAGTTTTTACTGCATATGGTGCCATGGCCCATGCTGCTGAAGTGCGCCCTGGGGATTCTGTTGCTATTATTGGAATTGGAGGTGTTGGTTCAAGGTAA MYSMGGLAEYCVTPAHGVSILPKSLPYTESAILGCAVFTAYGAMAHAAEVRPGDSVAIIGIGGVGSR Homology
BLAST of Lsi01G020170 vs. ExPASy Swiss-Prot
Match: A4YGN0 (Succinate-semialdehyde dehydrogenase (acetylating) OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348 / JCM 9185 / NBRC 15509 / TH2) OX=399549 GN=Msed_1424 PE=1 SV=1) HSP 1 Score: 58.2 bits (139), Expect = 4.3e-08 Identity = 26/61 (42.62%), Postives = 44/61 (72.13%), Query Frame = 0
BLAST of Lsi01G020170 vs. ExPASy Swiss-Prot
Match: Q7U1B9 (Alcohol dehydrogenase B OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=adhB PE=3 SV=1) HSP 1 Score: 57.0 bits (136), Expect = 9.5e-08 Identity = 27/65 (41.54%), Postives = 39/65 (60.00%), Query Frame = 0
BLAST of Lsi01G020170 vs. ExPASy Swiss-Prot
Match: P9WQC6 (Alcohol dehydrogenase B OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=adhB PE=3 SV=1) HSP 1 Score: 57.0 bits (136), Expect = 9.5e-08 Identity = 27/65 (41.54%), Postives = 39/65 (60.00%), Query Frame = 0
BLAST of Lsi01G020170 vs. ExPASy Swiss-Prot
Match: P9WQC7 (Alcohol dehydrogenase B OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=adhB PE=1 SV=1) HSP 1 Score: 57.0 bits (136), Expect = 9.5e-08 Identity = 27/65 (41.54%), Postives = 39/65 (60.00%), Query Frame = 0
BLAST of Lsi01G020170 vs. ExPASy Swiss-Prot
Match: O97764 (Zeta-crystallin OS=Bos taurus OX=9913 GN=CRYZ PE=2 SV=2) HSP 1 Score: 54.7 bits (130), Expect = 4.7e-07 Identity = 29/62 (46.77%), Postives = 39/62 (62.90%), Query Frame = 0
BLAST of Lsi01G020170 vs. ExPASy TrEMBL
Match: A0A0A0L305 (Oxidoreductase OS=Cucumis sativus OX=3659 GN=Csa_4G337920 PE=4 SV=1) HSP 1 Score: 135.6 bits (340), Expect = 7.8e-29 Identity = 67/67 (100.00%), Postives = 67/67 (100.00%), Query Frame = 0
BLAST of Lsi01G020170 vs. ExPASy TrEMBL
Match: A0A5A7V7N1 (Alcohol dehydrogenase OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold325G001550 PE=4 SV=1) HSP 1 Score: 132.1 bits (331), Expect = 8.6e-28 Identity = 65/67 (97.01%), Postives = 66/67 (98.51%), Query Frame = 0
BLAST of Lsi01G020170 vs. ExPASy TrEMBL
Match: A0A1S3BLX2 (alcohol dehydrogenase OS=Cucumis melo OX=3656 GN=LOC103491279 PE=4 SV=1) HSP 1 Score: 130.2 bits (326), Expect = 3.3e-27 Identity = 64/66 (96.97%), Postives = 65/66 (98.48%), Query Frame = 0
BLAST of Lsi01G020170 vs. ExPASy TrEMBL
Match: A0A6J1E0R2 (alcohol dehydrogenase 1B OS=Momordica charantia OX=3673 GN=LOC111024875 PE=4 SV=1) HSP 1 Score: 129.4 bits (324), Expect = 5.6e-27 Identity = 64/66 (96.97%), Postives = 66/66 (100.00%), Query Frame = 0
BLAST of Lsi01G020170 vs. ExPASy TrEMBL
Match: A0A6A1V7A8 (Succinate-semialdehyde dehydrogenase (Acetylating) OS=Morella rubra OX=262757 GN=CJ030_MR1G029160 PE=4 SV=1) HSP 1 Score: 127.5 bits (319), Expect = 2.1e-26 Identity = 61/67 (91.04%), Postives = 64/67 (95.52%), Query Frame = 0
BLAST of Lsi01G020170 vs. NCBI nr
Match: XP_004142661.1 (uncharacterized protein LOC101207246 [Cucumis sativus] >KAE8649602.1 hypothetical protein Csa_012208 [Cucumis sativus]) HSP 1 Score: 133.7 bits (335), Expect = 6.1e-28 Identity = 66/66 (100.00%), Postives = 66/66 (100.00%), Query Frame = 0
BLAST of Lsi01G020170 vs. NCBI nr
Match: XP_038903768.1 (alcohol dehydrogenase [Benincasa hispida]) HSP 1 Score: 133.3 bits (334), Expect = 8.0e-28 Identity = 65/66 (98.48%), Postives = 66/66 (100.00%), Query Frame = 0
BLAST of Lsi01G020170 vs. NCBI nr
Match: KAA0062426.1 (alcohol dehydrogenase [Cucumis melo var. makuwa] >TYK27455.1 alcohol dehydrogenase [Cucumis melo var. makuwa]) HSP 1 Score: 132.1 bits (331), Expect = 1.8e-27 Identity = 65/67 (97.01%), Postives = 66/67 (98.51%), Query Frame = 0
BLAST of Lsi01G020170 vs. NCBI nr
Match: XP_008449387.1 (PREDICTED: alcohol dehydrogenase [Cucumis melo]) HSP 1 Score: 130.2 bits (326), Expect = 6.7e-27 Identity = 64/66 (96.97%), Postives = 65/66 (98.48%), Query Frame = 0
BLAST of Lsi01G020170 vs. NCBI nr
Match: XP_022158376.1 (alcohol dehydrogenase 1B [Momordica charantia]) HSP 1 Score: 129.4 bits (324), Expect = 1.1e-26 Identity = 64/66 (96.97%), Postives = 66/66 (100.00%), Query Frame = 0
BLAST of Lsi01G020170 vs. TAIR 10
Match: AT5G63620.1 (GroES-like zinc-binding alcohol dehydrogenase family protein ) HSP 1 Score: 123.6 bits (309), Expect = 5.9e-29 Identity = 57/66 (86.36%), Postives = 65/66 (98.48%), Query Frame = 0
BLAST of Lsi01G020170 vs. TAIR 10
Match: AT5G63620.2 (GroES-like zinc-binding alcohol dehydrogenase family protein ) HSP 1 Score: 123.6 bits (309), Expect = 5.9e-29 Identity = 57/66 (86.36%), Postives = 65/66 (98.48%), Query Frame = 0
BLAST of Lsi01G020170 vs. TAIR 10
Match: AT5G43940.1 (GroES-like zinc-binding dehydrogenase family protein ) HSP 1 Score: 41.6 bits (96), Expect = 2.9e-04 Identity = 22/58 (37.93%), Postives = 34/58 (58.62%), Query Frame = 0
BLAST of Lsi01G020170 vs. TAIR 10
Match: AT5G43940.2 (GroES-like zinc-binding dehydrogenase family protein ) HSP 1 Score: 41.6 bits (96), Expect = 2.9e-04 Identity = 22/58 (37.93%), Postives = 34/58 (58.62%), Query Frame = 0
BLAST of Lsi01G020170 vs. TAIR 10
Match: AT1G22430.1 (GroES-like zinc-binding dehydrogenase family protein ) HSP 1 Score: 41.2 bits (95), Expect = 3.8e-04 Identity = 25/63 (39.68%), Postives = 35/63 (55.56%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bottle gourd (USVL1VR-Ls) v1
Date Performed: 2021-10-18
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|