![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
Lsi01G018330 (gene) Bottle gourd (USVL1VR-Ls) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCACGTCGAGGTACTGCAGAAGAAAAAATTGCAAAATTCGATCCAATTTATCGTAATCGATTAGTTAACATGTTGGTTAACCGTATTCTGAAACACGAAAAAAAATCATTGGCTTATCAAATTATCTATCGAGCCATGAAAAAGATTCAACAAAAGACAGAAACAAATCCACCATCTGTTTTACGTCAAGCAATTCGTGGAGTAACTCCCGATATAGCAGTAAAGGCAAGACGTGTAGGCAGATCAACTCATCAAGTTCCCATTGAAATAGGATCCACACAAGGAAAAACACTTGTCATTCGTTGGTTATTAGGGGCATTCCGAAAACGTCCGGGTCGAAAAGGGTTTGTGAAGAATCAATCACAACAAGAAGGGTACATTACATAA ATGTCACGTCGAGGTACTGCAGAAGAAAAAATTGCAAAATTCGATCCAATTTATCGTAATCGATTAGTTAACATGTTGGTTAACCGTATTCTGAAACACGAAAAAAAATCATTGGCTTATCAAATTATCTATCGAGCCATGAAAAAGATTCAACAAAAGACAGAAACAAATCCACCATCTGTTTTACGTCAAGCAATTCGTGGAGTAACTCCCGATATAGCAGTAAAGGCAAGACGTGTAGGCAGATCAACTCATCAAGTTCCCATTGAAATAGGATCCACACAAGGAAAAACACTTGTCATTCGTTGGTTATTAGGGGCATTCCGAAAACGTCCGGGTCGAAAAGGGTTTGTGAAGAATCAATCACAACAAGAAGGGTACATTACATAA ATGTCACGTCGAGGTACTGCAGAAGAAAAAATTGCAAAATTCGATCCAATTTATCGTAATCGATTAGTTAACATGTTGGTTAACCGTATTCTGAAACACGAAAAAAAATCATTGGCTTATCAAATTATCTATCGAGCCATGAAAAAGATTCAACAAAAGACAGAAACAAATCCACCATCTGTTTTACGTCAAGCAATTCGTGGAGTAACTCCCGATATAGCAGTAAAGGCAAGACGTGTAGGCAGATCAACTCATCAAGTTCCCATTGAAATAGGATCCACACAAGGAAAAACACTTGTCATTCGTTGGTTATTAGGGGCATTCCGAAAACGTCCGGGTCGAAAAGGGTTTGTGAAGAATCAATCACAACAAGAAGGGTACATTACATAA MSRRGTAEEKIAKFDPIYRNRLVNMLVNRILKHEKKSLAYQIIYRAMKKIQQKTETNPPSVLRQAIRGVTPDIAVKARRVGRSTHQVPIEIGSTQGKTLVIRWLLGAFRKRPGRKGFVKNQSQQEGYIT Homology
BLAST of Lsi01G018330 vs. ExPASy Swiss-Prot
Match: Q09WV9 (30S ribosomal protein S7, chloroplastic OS=Morus indica OX=248361 GN=rps7-A PE=3 SV=1) HSP 1 Score: 204.5 bits (519), Expect = 7.1e-52 Identity = 108/123 (87.80%), Postives = 109/123 (88.62%), Query Frame = 0
BLAST of Lsi01G018330 vs. ExPASy Swiss-Prot
Match: Q4VZK9 (30S ribosomal protein S7, chloroplastic OS=Cucumis sativus OX=3659 GN=rps7-A PE=3 SV=1) HSP 1 Score: 204.1 bits (518), Expect = 9.3e-52 Identity = 108/123 (87.80%), Postives = 109/123 (88.62%), Query Frame = 0
BLAST of Lsi01G018330 vs. ExPASy Swiss-Prot
Match: Q49KT8 (30S ribosomal protein S7, chloroplastic OS=Eucalyptus globulus subsp. globulus OX=71271 GN=rps7-A PE=3 SV=1) HSP 1 Score: 204.1 bits (518), Expect = 9.3e-52 Identity = 108/123 (87.80%), Postives = 109/123 (88.62%), Query Frame = 0
BLAST of Lsi01G018330 vs. ExPASy Swiss-Prot
Match: Q6KGY2 (30S ribosomal protein S7, chloroplastic OS=Gunnera chilensis OX=130722 GN=rps7 PE=3 SV=1) HSP 1 Score: 204.1 bits (518), Expect = 9.3e-52 Identity = 108/123 (87.80%), Postives = 109/123 (88.62%), Query Frame = 0
BLAST of Lsi01G018330 vs. ExPASy Swiss-Prot
Match: B1NWJ5 (30S ribosomal protein S7, chloroplastic OS=Manihot esculenta OX=3983 GN=rps7-A PE=3 SV=1) HSP 1 Score: 204.1 bits (518), Expect = 9.3e-52 Identity = 108/123 (87.80%), Postives = 109/123 (88.62%), Query Frame = 0
BLAST of Lsi01G018330 vs. ExPASy TrEMBL
Match: A0A1V0IUB0 (Ribosomal protein S7 OS=Margyricarpus pinnatus OX=281856 GN=rps7 PE=3 SV=1) HSP 1 Score: 206.5 bits (524), Expect = 6.9e-50 Identity = 108/123 (87.80%), Postives = 110/123 (89.43%), Query Frame = 0
BLAST of Lsi01G018330 vs. ExPASy TrEMBL
Match: A0A346IS23 (30S ribosomal protein S7, chloroplastic OS=Anemone henryi OX=387290 GN=rps7 PE=3 SV=1) HSP 1 Score: 206.1 bits (523), Expect = 9.0e-50 Identity = 108/123 (87.80%), Postives = 110/123 (89.43%), Query Frame = 0
BLAST of Lsi01G018330 vs. ExPASy TrEMBL
Match: A0A650FFZ0 (30S ribosomal protein S7, chloroplastic OS=Anemone turczaninovii OX=748721 GN=rps7 PE=3 SV=1) HSP 1 Score: 206.1 bits (523), Expect = 9.0e-50 Identity = 108/123 (87.80%), Postives = 110/123 (89.43%), Query Frame = 0
BLAST of Lsi01G018330 vs. ExPASy TrEMBL
Match: A0A0H3Y467 (30S ribosomal protein S7, chloroplastic OS=Anemone pratensis OX=445229 GN=rps7 PE=3 SV=1) HSP 1 Score: 206.1 bits (523), Expect = 9.0e-50 Identity = 108/123 (87.80%), Postives = 110/123 (89.43%), Query Frame = 0
BLAST of Lsi01G018330 vs. ExPASy TrEMBL
Match: A0A6M3RUB1 (30S ribosomal protein S7, chloroplastic OS=Trichosanthes rosthornii OX=676073 GN=rps7 PE=3 SV=1) HSP 1 Score: 206.1 bits (523), Expect = 9.0e-50 Identity = 109/123 (88.62%), Postives = 110/123 (89.43%), Query Frame = 0
BLAST of Lsi01G018330 vs. NCBI nr
Match: ARD00025.1 (ribosomal protein S7 [Margyricarpus pinnatus]) HSP 1 Score: 206.5 bits (524), Expect = 1.4e-49 Identity = 108/123 (87.80%), Postives = 110/123 (89.43%), Query Frame = 0
BLAST of Lsi01G018330 vs. NCBI nr
Match: QPD79335.1 (ribosomal protein S7 [Anemone nemorosa]) HSP 1 Score: 206.1 bits (523), Expect = 1.9e-49 Identity = 108/123 (87.80%), Postives = 110/123 (89.43%), Query Frame = 0
BLAST of Lsi01G018330 vs. NCBI nr
Match: YP_009169398.1 (ribosomal protein S7 [Clematis terniflora] >YP_009169410.1 ribosomal protein S7 [Clematis terniflora] >YP_009469486.1 ribosomal protein S7 [Anemoclema glaucifolium] >YP_009469499.1 ribosomal protein S7 [Anemoclema glaucifolium] >YP_009517749.1 ribosomal protein S7 [Anemone chinensis] >YP_009517762.1 ribosomal protein S7 [Anemone chinensis] >YP_009517950.1 ribosomal protein S7 [Anemone trullifolia] >YP_009517963.1 ribosomal protein S7 [Anemone trullifolia] >YP_009518708.1 ribosomal protein S7 [Anemone henryi] >YP_009518721.1 ribosomal protein S7 [Anemone henryi] >YP_009519963.1 ribosomal protein S7 [Naravelia pilulifera] >YP_009519976.1 ribosomal protein S7 [Naravelia pilulifera] >YP_009521701.1 ribosomal protein S7 [Clematis alternata] >YP_009521714.1 ribosomal protein S7 [Clematis alternata] >YP_009521791.1 ribosomal protein S7 [Clematis repens] >YP_009521804.1 ribosomal protein S7 [Clematis repens] >YP_009521881.1 ribosomal protein S7 [Clematis brevicaudata] >YP_009521893.1 ribosomal protein S7 [Clematis brevicaudata] >YP_009521971.1 ribosomal protein S7 [Naravelia zeylanica] >YP_009521984.1 ribosomal protein S7 [Naravelia zeylanica] >YP_009528049.1 ribosomal protein S7 [Clematis loureiroana] >YP_009528062.1 ribosomal protein S7 [Clematis loureiroana] >YP_009536937.1 ribosomal protein S7 [Clematis acerifolia] >YP_009536950.1 ribosomal protein S7 [Clematis acerifolia] >YP_009537028.1 ribosomal protein S7 [Clematis heracleifolia] >YP_009537040.1 ribosomal protein S7 [Clematis heracleifolia] >YP_009537118.1 ribosomal protein S7 [Clematis uncinata] >YP_009537130.1 ribosomal protein S7 [Clematis uncinata] >YP_009576980.1 ribosomal protein S7 [Clematis macropetala] >YP_009576992.1 ribosomal protein S7 [Clematis macropetala] >YP_009580565.1 ribosomal protein S7 [Anemone raddeana] >YP_009580577.1 ribosomal protein S7 [Anemone raddeana] >YP_009654252.1 ribosomal protein S7 [Clematis brachyura] >YP_009654265.1 ribosomal protein S7 [Clematis brachyura] >YP_009671743.1 ribosomal protein S7 [Clematis trichotoma] >YP_009671756.1 ribosomal protein S7 [Clematis trichotoma] >YP_009727537.1 ribosomal protein S7 [Anemone hepatica var. japonica] >YP_009727549.1 ribosomal protein S7 [Anemone hepatica var. japonica] >YP_009727626.1 ribosomal protein S7 [Anemone narcissiflora] >YP_009727638.1 ribosomal protein S7 [Anemone narcissiflora] >YP_009728865.1 ribosomal protein S7 [Anemone cernua var. koreana] >YP_009728877.1 ribosomal protein S7 [Anemone cernua var. koreana] >YP_009728953.1 ribosomal protein S7 [Anemone maxima] >YP_009728965.1 ribosomal protein S7 [Anemone maxima] >YP_009729041.1 ribosomal protein S7 [Anemone hepatica var. asiatica] >YP_009729053.1 ribosomal protein S7 [Anemone hepatica var. asiatica] >YP_009922128.1 ribosomal protein S7 [Clematis guniuensis] >YP_009922140.1 ribosomal protein S7 [Clematis guniuensis] >YP_009936885.1 ribosomal protein S7 [Anemone taipaiensis] >YP_009936898.1 ribosomal protein S7 [Anemone taipaiensis] >YP_010044694.1 ribosomal protein S7 [Anemone reflexa] >YP_010044706.1 ribosomal protein S7 [Anemone reflexa] >YP_010047286.1 ribosomal protein S7 [Clematis taeguensis] >YP_010047363.1 ribosomal protein S7 [Clematis taeguensis] >YP_010128773.1 30S ribosomal protein S7 [Clematis glauca] >YP_010128786.1 30S ribosomal protein S7 [Clematis glauca] >AIZ57573.1 ribosomal protein S7 [Clematis fusca var. coreana] >AKM98117.1 ribosomal protein S7 [Anemone patens] >AKM98293.1 ribosomal protein S7 [Anemone pratensis] >AKM98469.1 ribosomal protein S7 [Anemone vernalis] >QFV17336.1 ribosomal protein S7 [Clematis tangutica] >QFV18693.1 ribosomal protein S7 [Clematis aethusifolia] >QGU85075.1 ribosomal protein S7 [Anemone chinensis x Anemone cernua] >QGU85164.1 ribosomal protein S7 [Anemone cernua] >QGU85253.1 ribosomal protein S7 [Anemone dahurica] >QGU85342.1 ribosomal protein S7 [Anemone turczaninovii] >QJS33365.1 ribosomal protein S7 [Anemone flaccida] >QQQ87845.1 ribosomal protein S7 [Clematis henryi var. ternata] >QRN74068.1 ribosomal protein S7 [Clematis montana] >QWV61641.1 ribosomal protein S7 [Clematis fruticosa] >QZH79354.1 ribosomal protein S7 [Clematis chinensis]) HSP 1 Score: 206.1 bits (523), Expect = 1.9e-49 Identity = 108/123 (87.80%), Postives = 110/123 (89.43%), Query Frame = 0
BLAST of Lsi01G018330 vs. NCBI nr
Match: YP_009753134.1 (ribosomal protein S7 [Corallocarpus boehmii] >YP_009753148.1 ribosomal protein S7 [Corallocarpus boehmii] >QIT06206.1 ribosomal protein S7 [Corallocarpus boehmii] >QIT06220.1 ribosomal protein S7 [Corallocarpus boehmii]) HSP 1 Score: 206.1 bits (523), Expect = 1.9e-49 Identity = 109/123 (88.62%), Postives = 110/123 (89.43%), Query Frame = 0
BLAST of Lsi01G018330 vs. NCBI nr
Match: WP_131767149.1 (30S ribosomal protein S7 [Candidatus Frankia datiscae] >YP_004841829.1 ribosomal protein S7 [Cucumis melo subsp. melo] >YP_004841845.1 ribosomal protein S7 [Cucumis melo subsp. melo] >YP_009236323.1 ribosomal protein S7 [Gynostemma pentaphyllum] >YP_009236335.1 ribosomal protein S7 [Gynostemma pentaphyllum] >YP_009317431.1 ribosomal protein S7 [Coccinia grandis] >YP_009317445.1 ribosomal protein S7 [Coccinia grandis] >YP_009326035.1 ribosomal protein S7 [Citrullus lanatus] >YP_009326050.1 ribosomal protein S7 [Citrullus lanatus] >YP_009348077.1 ribosomal protein S7 [Citrullus mucosospermus] >YP_009348092.1 ribosomal protein S7 [Citrullus mucosospermus] >YP_009420840.1 ribosomal protein S7 [Citrullus colocynthis] >YP_009420855.1 ribosomal protein S7 [Citrullus colocynthis] >YP_009430672.1 ribosomal protein S7 [Gynostemma cardiospermum] >YP_009430688.1 ribosomal protein S7 [Gynostemma cardiospermum] >YP_009431602.1 ribosomal protein S7 [Citrullus amarus] >YP_009431617.1 ribosomal protein S7 [Citrullus amarus] >YP_009431688.1 ribosomal protein S7 [Citrullus rehmii] >YP_009431703.1 ribosomal protein S7 [Citrullus rehmii] >YP_009439849.1 ribosomal protein S7 [Gynostemma laxiflorum] >YP_009439865.1 ribosomal protein S7 [Gynostemma laxiflorum] >YP_009440023.1 ribosomal protein S7 [Gynostemma pentagynum] >YP_009440039.1 ribosomal protein S7 [Gynostemma pentagynum] >YP_009440202.1 ribosomal protein S7 [Gynostemma longipes] >YP_009440218.1 ribosomal protein S7 [Gynostemma longipes] >YP_009440289.1 ribosomal protein S7 [Gynostemma burmanicum (nom. inval.)] >YP_009440305.1 ribosomal protein S7 [Gynostemma burmanicum (nom. inval.)] >YP_009440376.1 ribosomal protein S7 [Gynostemma pubescens] >YP_009440392.1 ribosomal protein S7 [Gynostemma pubescens] >YP_009456106.1 ribosomal protein S7 [Momordica charantia] >YP_009456122.1 ribosomal protein S7 [Momordica charantia] >YP_009456191.1 ribosomal protein S7 [Lagenaria siceraria] >YP_009456207.1 ribosomal protein S7 [Lagenaria siceraria] >YP_009468906.1 ribosomal protein S7 [Gynostemma compressum] >YP_009468922.1 ribosomal protein S7 [Gynostemma compressum] >YP_009525231.1 ribosomal protein S7 [Hodgsonia macrocarpa] >YP_009525244.1 ribosomal protein S7 [Hodgsonia macrocarpa] >YP_009526347.1 ribosomal protein S7 [Hemsleya lijiangensis] >YP_009526363.1 ribosomal protein S7 [Hemsleya lijiangensis] >YP_009560881.1 ribosomal protein S7 [Trichosanthes kirilowii] >YP_009560894.1 ribosomal protein S7 [Trichosanthes kirilowii] >YP_009669949.1 ribosomal protein S7 [Salvertia convallariodora] >YP_009669965.1 ribosomal protein S7 [Salvertia convallariodora] >YP_009674436.1 ribosomal protein S7 [Siraitia grosvenorii] >YP_009674451.1 ribosomal protein S7 [Siraitia grosvenorii] >YP_009707934.1 ribosomal protein S7 [Begonia pulchrifolia] >YP_009707950.1 ribosomal protein S7 [Begonia pulchrifolia] >YP_009738248.1 ribosomal protein S7 [Siraitia siamensis] >YP_009738263.1 ribosomal protein S7 [Siraitia siamensis] >YP_009751530.1 ribosomal protein S7 [Thladiantha dubia] >YP_009751544.1 ribosomal protein S7 [Thladiantha dubia] >YP_009751698.1 ribosomal protein S7 [Hodgsonia heteroclita] >YP_009751712.1 ribosomal protein S7 [Hodgsonia heteroclita] >YP_009751783.1 ribosomal protein S7 [Herpetospermum pedunculosum] >YP_009751796.1 ribosomal protein S7 [Herpetospermum pedunculosum] >YP_009751867.1 ribosomal protein S7 [Indofevillea khasiana] >YP_009751880.1 ribosomal protein S7 [Indofevillea khasiana] >YP_009751951.1 ribosomal protein S7 [Cyclanthera pedata] >YP_009751964.1 ribosomal protein S7 [Cyclanthera pedata] >YP_009752120.1 ribosomal protein S7 [Dendrosicyos socotranus] >YP_009752133.1 ribosomal protein S7 [Dendrosicyos socotranus] >YP_009752203.1 ribosomal protein S7 [Linnaeosicyos amara] >YP_009752288.1 ribosomal protein S7 [Trichosanthes baviensis] >YP_009752301.1 ribosomal protein S7 [Trichosanthes baviensis] >YP_009752372.1 ribosomal protein S7 [Bryonia marmorata] >YP_009752386.1 ribosomal protein S7 [Bryonia marmorata] >YP_009752457.1 ribosomal protein S7 [Trichosanthes tricuspidata] >YP_009752470.1 ribosomal protein S7 [Trichosanthes tricuspidata] >YP_009752541.1 ribosomal protein S7 [Trichosanthes tubiflora] >YP_009752555.1 ribosomal protein S7 [Trichosanthes tubiflora] >YP_009752626.1 ribosomal protein S7 [Trichosanthes homophylla] >YP_009752640.1 ribosomal protein S7 [Trichosanthes homophylla] >YP_009752711.1 ribosomal protein S7 [Ampelosycios humblotii] >YP_009752724.1 ribosomal protein S7 [Ampelosycios humblotii] >YP_009752880.1 ribosomal protein S7 [Baijiania yunnanensis] >YP_009752894.1 ribosomal protein S7 [Baijiania yunnanensis] >YP_009752965.1 ribosomal protein S7 [Momordica sessilifolia] >YP_009752978.1 ribosomal protein S7 [Momordica sessilifolia] >YP_009753049.1 ribosomal protein S7 [Gerrardanthus macrorhizus] >YP_009753063.1 ribosomal protein S7 [Gerrardanthus macrorhizus] >YP_009753219.1 ribosomal protein S7 [Trichosanthes truncata] >YP_009753232.1 ribosomal protein S7 [Trichosanthes truncata] >YP_009753302.1 ribosomal protein S7 [Nothoalsomitra suberosa] >YP_009753316.1 ribosomal protein S7 [Nothoalsomitra suberosa] >YP_009753665.1 ribosomal protein S7 [Trichosanthes wallichiana] >YP_009753679.1 ribosomal protein S7 [Trichosanthes wallichiana] >YP_009753750.1 ribosomal protein S7 [Trichosanthes nervifolia] >YP_009753763.1 ribosomal protein S7 [Trichosanthes nervifolia] >YP_009753834.1 ribosomal protein S7 [Trichosanthes pilosa] >YP_009753848.1 ribosomal protein S7 [Trichosanthes pilosa] >YP_009753919.1 ribosomal protein S7 [Trichosanthes lobata] >YP_009753933.1 ribosomal protein S7 [Trichosanthes lobata] >YP_009775179.1 ribosomal protein S7 [Begonia versicolor] >YP_009775192.1 ribosomal protein S7 [Begonia versicolor] >YP_009860119.1 ribosomal protein S7 [Cucumis melo subsp. agrestis] >YP_009860135.1 ribosomal protein S7 [Cucumis melo subsp. agrestis] >YP_009945460.1 ribosomal protein S7 [Sechium edule] >YP_009945471.1 ribosomal protein S7 [Sechium edule] >YP_010015184.1 ribosomal protein S7 [Gynostemma yixingense] >YP_010015200.1 ribosomal protein S7 [Gynostemma yixingense] >YP_010117490.1 ribosomal protein S7 [Begonia coptidifolia] >YP_010117561.1 ribosomal protein S7 [Begonia coptidifolia] >YP_010119779.1 ribosomal protein S7 [Hemsleya zhejiangensis] >YP_010119794.1 ribosomal protein S7 [Hemsleya zhejiangensis] >YP_010131139.1 ribosomal protein S7 [Benincasa hispida] >YP_010131152.1 ribosomal protein S7 [Benincasa hispida] >APW82508.1 ribosomal protein S7 [Citrullus lanatus subsp. vulgaris] >ASY96646.1 ribosomal protein S7 [Cucumis melo var. conomon] >ASY96734.1 ribosomal protein S7 [Cucumis melo var. makuwa] >ASY96821.1 ribosomal protein S7 [Cucumis melo var. momordica] >ASY96908.1 ribosomal protein S7 [Cucumis melo var. dudaim] >ASY96995.1 ribosomal protein S7 [Cucumis melo var. cantalupo] >ASY97169.1 ribosomal protein S7 [Cucumis melo var. inodorus] >ASY97343.1 ribosomal protein S7 [Cucumis melo var. flexuosus] >AXU40435.1 ribosomal protein S7 [Gomphogyne cissiformis var. villosa] >AXU40609.1 ribosomal protein S7 [Gomphogyne cissiformis var. cissiformis] >QIT04095.1 ribosomal protein S7 [Luffa aegyptiaca] >QJD26515.1 ribosomal protein S7 [Trichosanthes kirilowii var. japonica] >QJD26689.1 ribosomal protein S7 [Trichosanthes rosthornii] >QJF46430.1 ribosomal protein S7 [Cucumis melo] >QKX48520.1 ribosomal protein S7 [Luffa acutangula] >QNM38576.1 ribosomal protein S7 [Lagenaria siceraria var. microcarpa] >QZL38639.1 ribosomal protein S7 [Citrullus naudinianus] >QZL38727.1 ribosomal protein S7 [Citrullus ecirrhosus]) HSP 1 Score: 206.1 bits (523), Expect = 1.9e-49 Identity = 109/123 (88.62%), Postives = 110/123 (89.43%), Query Frame = 0
BLAST of Lsi01G018330 vs. TAIR 10
Match: ATCG01240.1 (ribosomal protein S7 ) HSP 1 Score: 203.0 bits (515), Expect = 1.5e-52 Identity = 107/123 (86.99%), Postives = 109/123 (88.62%), Query Frame = 0
BLAST of Lsi01G018330 vs. TAIR 10
Match: ATCG00900.1 (Ribosomal protein S7p/S5e family protein ) HSP 1 Score: 203.0 bits (515), Expect = 1.5e-52 Identity = 107/123 (86.99%), Postives = 109/123 (88.62%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bottle gourd (USVL1VR-Ls) v1
Date Performed: 2021-10-18 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|