![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
Lsi01G001940 (gene) Bottle gourd (USVL1VR-Ls) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAGGCGATGAGGATGTCATATTATCCGCCATGCCCGGCACCCGAGTTGGTGGTCGGTCTGAGGCCGCACTCTGATGCGTCGGGGCTGACCATCTTGAACCAGCTGAATGGAGTGGAAGGCCTCCAAGTTAAAAAAGATGGCATTTGGTTCCCTGTGAGTTTCATTCCAGATGCTTTCATTGTCAACGTTGGAGATATTCTTGAGGTTTAA ATGGAGGCGATGAGGATGTCATATTATCCGCCATGCCCGGCACCCGAGTTGGTGGTCGGTCTGAGGCCGCACTCTGATGCGTCGGGGCTGACCATCTTGAACCAGCTGAATGGAGTGGAAGGCCTCCAAGTTAAAAAAGATGGCATTTGGTTCCCTGTGAGTTTCATTCCAGATGCTTTCATTGTCAACGTTGGAGATATTCTTGAGGTTTAA ATGGAGGCGATGAGGATGTCATATTATCCGCCATGCCCGGCACCCGAGTTGGTGGTCGGTCTGAGGCCGCACTCTGATGCGTCGGGGCTGACCATCTTGAACCAGCTGAATGGAGTGGAAGGCCTCCAAGTTAAAAAAGATGGCATTTGGTTCCCTGTGAGTTTCATTCCAGATGCTTTCATTGTCAACGTTGGAGATATTCTTGAGGTTTAA MEAMRMSYYPPCPAPELVVGLRPHSDASGLTILNQLNGVEGLQVKKDGIWFPVSFIPDAFIVNVGDILEV Homology
BLAST of Lsi01G001940 vs. ExPASy Swiss-Prot
Match: Q39224 (Protein SRG1 OS=Arabidopsis thaliana OX=3702 GN=SRG1 PE=2 SV=1) HSP 1 Score: 109.8 bits (273), Expect = 1.3e-23 Identity = 45/70 (64.29%), Postives = 60/70 (85.71%), Query Frame = 0
BLAST of Lsi01G001940 vs. ExPASy Swiss-Prot
Match: D4N501 (Probable 2-oxoglutarate/Fe(II)-dependent dioxygenase OS=Papaver somniferum OX=3469 GN=DIOX2 PE=2 SV=1) HSP 1 Score: 105.1 bits (261), Expect = 3.2e-22 Identity = 45/69 (65.22%), Postives = 55/69 (79.71%), Query Frame = 0
BLAST of Lsi01G001940 vs. ExPASy Swiss-Prot
Match: D4N502 (Codeine O-demethylase OS=Papaver somniferum OX=3469 GN=CODM PE=1 SV=1) HSP 1 Score: 105.1 bits (261), Expect = 3.2e-22 Identity = 47/70 (67.14%), Postives = 57/70 (81.43%), Query Frame = 0
BLAST of Lsi01G001940 vs. ExPASy Swiss-Prot
Match: D4N500 (Thebaine 6-O-demethylase OS=Papaver somniferum OX=3469 GN=T6ODM PE=1 SV=1) HSP 1 Score: 102.8 bits (255), Expect = 1.6e-21 Identity = 44/69 (63.77%), Postives = 55/69 (79.71%), Query Frame = 0
BLAST of Lsi01G001940 vs. ExPASy Swiss-Prot
Match: Q94LP4 (2-oxoglutarate-dependent dioxygenase 11 OS=Oryza sativa subsp. japonica OX=39947 GN=2ODD11 PE=1 SV=1) HSP 1 Score: 87.4 bits (215), Expect = 6.9e-17 Identity = 37/67 (55.22%), Postives = 49/67 (73.13%), Query Frame = 0
BLAST of Lsi01G001940 vs. ExPASy TrEMBL
Match: A0A5A7UA06 (Codeine O-demethylase-like isoform X1 OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold120G001880 PE=3 SV=1) HSP 1 Score: 144.4 bits (363), Expect = 1.7e-31 Identity = 66/70 (94.29%), Postives = 69/70 (98.57%), Query Frame = 0
BLAST of Lsi01G001940 vs. ExPASy TrEMBL
Match: A0A5D3CPF6 (Codeine O-demethylase-like isoform X1 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold255G008590 PE=3 SV=1) HSP 1 Score: 144.4 bits (363), Expect = 1.7e-31 Identity = 66/70 (94.29%), Postives = 69/70 (98.57%), Query Frame = 0
BLAST of Lsi01G001940 vs. ExPASy TrEMBL
Match: A0A1S3AYY1 (codeine O-demethylase-like OS=Cucumis melo OX=3656 GN=LOC103484411 PE=3 SV=1) HSP 1 Score: 144.4 bits (363), Expect = 1.7e-31 Identity = 66/70 (94.29%), Postives = 69/70 (98.57%), Query Frame = 0
BLAST of Lsi01G001940 vs. ExPASy TrEMBL
Match: A0A6J1CKJ4 (protein SRG1-like OS=Momordica charantia OX=3673 GN=LOC111012449 PE=3 SV=1) HSP 1 Score: 144.1 bits (362), Expect = 2.3e-31 Identity = 65/70 (92.86%), Postives = 69/70 (98.57%), Query Frame = 0
BLAST of Lsi01G001940 vs. ExPASy TrEMBL
Match: A0A0A0KHZ4 (Fe2OG dioxygenase domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_6G520480 PE=4 SV=1) HSP 1 Score: 141.4 bits (355), Expect = 1.5e-30 Identity = 64/70 (91.43%), Postives = 69/70 (98.57%), Query Frame = 0
BLAST of Lsi01G001940 vs. NCBI nr
Match: XP_038883393.1 (protein SRG1-like [Benincasa hispida]) HSP 1 Score: 146.7 bits (369), Expect = 7.3e-32 Identity = 68/70 (97.14%), Postives = 69/70 (98.57%), Query Frame = 0
BLAST of Lsi01G001940 vs. NCBI nr
Match: KAA0052582.1 (codeine O-demethylase-like isoform X1 [Cucumis melo var. makuwa]) HSP 1 Score: 144.4 bits (363), Expect = 3.6e-31 Identity = 66/70 (94.29%), Postives = 69/70 (98.57%), Query Frame = 0
BLAST of Lsi01G001940 vs. NCBI nr
Match: TYK13242.1 (codeine O-demethylase-like isoform X1 [Cucumis melo var. makuwa]) HSP 1 Score: 144.4 bits (363), Expect = 3.6e-31 Identity = 66/70 (94.29%), Postives = 69/70 (98.57%), Query Frame = 0
BLAST of Lsi01G001940 vs. NCBI nr
Match: XP_008439692.1 (PREDICTED: codeine O-demethylase-like [Cucumis melo]) HSP 1 Score: 144.4 bits (363), Expect = 3.6e-31 Identity = 66/70 (94.29%), Postives = 69/70 (98.57%), Query Frame = 0
BLAST of Lsi01G001940 vs. NCBI nr
Match: XP_022142295.1 (protein SRG1-like [Momordica charantia]) HSP 1 Score: 144.1 bits (362), Expect = 4.7e-31 Identity = 65/70 (92.86%), Postives = 69/70 (98.57%), Query Frame = 0
BLAST of Lsi01G001940 vs. TAIR 10
Match: AT1G17020.1 (senescence-related gene 1 ) HSP 1 Score: 109.8 bits (273), Expect = 9.2e-25 Identity = 45/70 (64.29%), Postives = 60/70 (85.71%), Query Frame = 0
BLAST of Lsi01G001940 vs. TAIR 10
Match: AT1G17010.1 (2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein ) HSP 1 Score: 104.4 bits (259), Expect = 3.9e-23 Identity = 47/70 (67.14%), Postives = 58/70 (82.86%), Query Frame = 0
BLAST of Lsi01G001940 vs. TAIR 10
Match: AT4G25310.1 (2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein ) HSP 1 Score: 102.4 bits (254), Expect = 1.5e-22 Identity = 44/69 (63.77%), Postives = 56/69 (81.16%), Query Frame = 0
BLAST of Lsi01G001940 vs. TAIR 10
Match: AT1G78550.1 (2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein ) HSP 1 Score: 94.7 bits (234), Expect = 3.1e-20 Identity = 41/69 (59.42%), Postives = 56/69 (81.16%), Query Frame = 0
BLAST of Lsi01G001940 vs. TAIR 10
Match: AT4G25300.1 (2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein ) HSP 1 Score: 93.2 bits (230), Expect = 8.9e-20 Identity = 40/69 (57.97%), Postives = 54/69 (78.26%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bottle gourd (USVL1VR-Ls) v1
Date Performed: 2021-10-18
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|