Lcy12g002420 (gene) Sponge gourd (P93075) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: five_prime_UTRexonCDSpolypeptidethree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.TTTCAGTGCAATTAATTATTTAAATGCATGAGCTGCTATATATATTGTCATCTTAAACTGCAATGTCTCTGTAGGTGGGGTGATATTGAGTTTCCATTGCCATTTGGAAGGGTTATGAGTGCAACTGAAAGCTTTATTCATGGCCTAGATGAAAAGGTGAAAAACAGTCCTATTTCTTACACATCTTTCAGCAAACCTCTTAAAAATCTTTCCTTACTTTCGTCACTGCTATGCTGTTTCTTATGTCAGAAGAAAGATTTATCAGCGTTAGTGGTTATACGGCCTCCAAATTTCACATACACTTTGATGTCTGTTAATCTGATATAGAACTCTCAGGATTCTGTTTTGGATCAAGGATAGTAAATAATGAAAACTGGAGG TTTCAGTGCAATTAATTATTTAAATGCATGAGCTGCTATATATATTGTCATCTTAAACTGCAATGTCTCTGTAGGTGGGGTGATATTGAGTTTCCATTGCCATTTGGAAGGGTTATGAGTGCAACTGAAAGCTTTATTCATGGCCTAGATGAAAAGGTGAAAAACAGTCCTATTTCTTACACATCTTTCAGCAAACCTCTTAAAAATCTTTCCTTACTTTCGTCACTGCTATGCTGTTTCTTATGTCAGAAGAAAGATTTATCAGCGTTAGTGGTTATACGGCCTCCAAATTTCACATACACTTTGATGTCTGTTAATCTGATATAGAACTCTCAGGATTCTGTTTTGGATCAAGGATAGTAAATAATGAAAACTGGAGG ATGAGCTGCTATATATATTGTCATCTTAAACTGCAATGTCTCTGTAGGTGGGGTGATATTGAGTTTCCATTGCCATTTGGAAGGGTTATGAGTGCAACTGAAAGCTTTATTCATGGCCTAGATGAAAAGGTGAAAAACAGTCCTATTTCTTACACATCTTTCAGCAAACCTCTTAAAAATCTTTCCTTACTTTCGTCACTGCTATGCTGTTTCTTATGTCAGAAGAAAGATTTATCAGCGTTAGTGGTTATACGGCCTCCAAATTTCACATACACTTTGATGTCTGTTAATCTGATATAG MSCYIYCHLKLQCLCRWGDIEFPLPFGRVMSATESFIHGLDEKVKNSPISYTSFSKPLKNLSLLSSLLCCFLCQKKDLSALVVIRPPNFTYTLMSVNLI Homology
BLAST of Lcy12g002420 vs. ExPASy Swiss-Prot
Match: Q9SGY2 (ATP-citrate synthase alpha chain protein 1 OS=Arabidopsis thaliana OX=3702 GN=ACLA-1 PE=1 SV=1) HSP 1 Score: 63.5 bits (153), Expect = 1.5e-09 Identity = 27/32 (84.38%), Postives = 28/32 (87.50%), Query Frame = 0
BLAST of Lcy12g002420 vs. ExPASy Swiss-Prot
Match: O22718 (ATP-citrate synthase alpha chain protein 2 OS=Arabidopsis thaliana OX=3702 GN=ACLA-2 PE=2 SV=1) HSP 1 Score: 63.5 bits (153), Expect = 1.5e-09 Identity = 26/32 (81.25%), Postives = 29/32 (90.62%), Query Frame = 0
BLAST of Lcy12g002420 vs. ExPASy Swiss-Prot
Match: O80526 (ATP-citrate synthase alpha chain protein 3 OS=Arabidopsis thaliana OX=3702 GN=ACLA-3 PE=2 SV=1) HSP 1 Score: 62.0 bits (149), Expect = 4.4e-09 Identity = 25/32 (78.12%), Postives = 29/32 (90.62%), Query Frame = 0
BLAST of Lcy12g002420 vs. ExPASy Swiss-Prot
Match: Q53JY8 (ATP-citrate synthase subunit alpha chain protein 1 OS=Oryza sativa subsp. japonica OX=39947 GN=ACLA-1 PE=3 SV=2) HSP 1 Score: 57.0 bits (136), Expect = 1.4e-07 Identity = 23/32 (71.88%), Postives = 27/32 (84.38%), Query Frame = 0
BLAST of Lcy12g002420 vs. ExPASy Swiss-Prot
Match: Q2QZ86 (ATP-citrate synthase alpha chain protein 2 OS=Oryza sativa subsp. japonica OX=39947 GN=ACLA-2 PE=2 SV=2) HSP 1 Score: 57.0 bits (136), Expect = 1.4e-07 Identity = 23/32 (71.88%), Postives = 27/32 (84.38%), Query Frame = 0
BLAST of Lcy12g002420 vs. ExPASy TrEMBL
Match: A0A072UE79 (ATP citrate synthase OS=Medicago truncatula OX=3880 GN=11407101 PE=3 SV=1) HSP 1 Score: 67.8 bits (164), Expect = 2.9e-08 Identity = 29/33 (87.88%), Postives = 30/33 (90.91%), Query Frame = 0
BLAST of Lcy12g002420 vs. ExPASy TrEMBL
Match: A0A0B2Q401 (ATP citrate synthase OS=Glycine soja OX=3848 GN=D0Y65_000288 PE=3 SV=1) HSP 1 Score: 65.5 bits (158), Expect = 1.5e-07 Identity = 28/32 (87.50%), Postives = 29/32 (90.62%), Query Frame = 0
BLAST of Lcy12g002420 vs. ExPASy TrEMBL
Match: A0A445LJC7 (ATP citrate synthase OS=Glycine soja OX=3848 GN=D0Y65_002875 PE=3 SV=1) HSP 1 Score: 65.5 bits (158), Expect = 1.5e-07 Identity = 28/32 (87.50%), Postives = 29/32 (90.62%), Query Frame = 0
BLAST of Lcy12g002420 vs. ExPASy TrEMBL
Match: I1J574 (ATP citrate synthase OS=Glycine max OX=3847 GN=GLYMA_01G028900 PE=3 SV=1) HSP 1 Score: 65.5 bits (158), Expect = 1.5e-07 Identity = 28/32 (87.50%), Postives = 29/32 (90.62%), Query Frame = 0
BLAST of Lcy12g002420 vs. ExPASy TrEMBL
Match: I1JC43 (ATP citrate synthase OS=Glycine max OX=3847 GN=GLYMA_02G036300 PE=3 SV=1) HSP 1 Score: 65.5 bits (158), Expect = 1.5e-07 Identity = 28/32 (87.50%), Postives = 29/32 (90.62%), Query Frame = 0
BLAST of Lcy12g002420 vs. NCBI nr
Match: XP_013453720.1 (ATP-citrate synthase alpha chain protein 1 isoform X1 [Medicago truncatula] >KEH27751.1 ATP-citrate synthase alpha chain protein [Medicago truncatula]) HSP 1 Score: 67.8 bits (164), Expect = 6.1e-08 Identity = 29/33 (87.88%), Postives = 30/33 (90.91%), Query Frame = 0
BLAST of Lcy12g002420 vs. NCBI nr
Match: XP_020206770.1 (ATP-citrate synthase alpha chain protein 2 isoform X1 [Cajanus cajan]) HSP 1 Score: 65.9 bits (159), Expect = 2.3e-07 Identity = 27/34 (79.41%), Postives = 30/34 (88.24%), Query Frame = 0
BLAST of Lcy12g002420 vs. NCBI nr
Match: XP_020206771.1 (ATP-citrate synthase alpha chain protein 2 isoform X2 [Cajanus cajan]) HSP 1 Score: 65.9 bits (159), Expect = 2.3e-07 Identity = 27/34 (79.41%), Postives = 30/34 (88.24%), Query Frame = 0
BLAST of Lcy12g002420 vs. NCBI nr
Match: RZC28210.1 (ATP-citrate synthase alpha chain protein 1 isoform D [Glycine soja]) HSP 1 Score: 65.5 bits (158), Expect = 3.0e-07 Identity = 28/32 (87.50%), Postives = 29/32 (90.62%), Query Frame = 0
BLAST of Lcy12g002420 vs. NCBI nr
Match: GAV70610.1 (ATP-grasp_2 domain-containing protein [Cephalotus follicularis]) HSP 1 Score: 65.5 bits (158), Expect = 3.0e-07 Identity = 28/32 (87.50%), Postives = 29/32 (90.62%), Query Frame = 0
BLAST of Lcy12g002420 vs. TAIR 10
Match: AT1G60810.1 (ATP-citrate lyase A-2 ) HSP 1 Score: 63.5 bits (153), Expect = 1.1e-10 Identity = 26/32 (81.25%), Postives = 29/32 (90.62%), Query Frame = 0
BLAST of Lcy12g002420 vs. TAIR 10
Match: AT1G10670.1 (ATP-citrate lyase A-1 ) HSP 1 Score: 63.5 bits (153), Expect = 1.1e-10 Identity = 27/32 (84.38%), Postives = 28/32 (87.50%), Query Frame = 0
BLAST of Lcy12g002420 vs. TAIR 10
Match: AT1G10670.2 (ATP-citrate lyase A-1 ) HSP 1 Score: 63.5 bits (153), Expect = 1.1e-10 Identity = 27/32 (84.38%), Postives = 28/32 (87.50%), Query Frame = 0
BLAST of Lcy12g002420 vs. TAIR 10
Match: AT1G10670.3 (ATP-citrate lyase A-1 ) HSP 1 Score: 63.5 bits (153), Expect = 1.1e-10 Identity = 27/32 (84.38%), Postives = 28/32 (87.50%), Query Frame = 0
BLAST of Lcy12g002420 vs. TAIR 10
Match: AT1G10670.4 (ATP-citrate lyase A-1 ) HSP 1 Score: 63.5 bits (153), Expect = 1.1e-10 Identity = 27/32 (84.38%), Postives = 28/32 (87.50%), Query Frame = 0
The following BLAST results are available for this feature:
Relationships
The following mRNA feature(s) are a part of this gene:
|