Lcy11g016210 (gene) Sponge gourd (P93075) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.TCATGTCGCTTTGGTCTCTTCCTTCTCCGCTCTGAGGGTTTTGAGCACTACCGCTGCGACCGCAACATCTCCATGGGTATGAACCTCAACAACATGGCTAAGATGCTCCGCTGTGCTGGCAACGATGACATTGTTATGCTGAAGGCCGAAGATAGTAGCGATTGCGTCACATTAATGTTCGAAAACCCTTGTGAGTAA TCATGTCGCTTTGGTCTCTTCCTTCTCCGCTCTGAGGGTTTTGAGCACTACCGCTGCGACCGCAACATCTCCATGGGTATGAACCTCAACAACATGGCTAAGATGCTCCGCTGTGCTGGCAACGATGACATTGTTATGCTGAAGGCCGAAGATAGTAGCGATTGCGTCACATTAATGTTCGAAAACCCTTGTGAGTAA TCATGTCGCTTTGGTCTCTTCCTTCTCCGCTCTGAGGGTTTTGAGCACTACCGCTGCGACCGCAACATCTCCATGGGTATGAACCTCAACAACATGGCTAAGATGCTCCGCTGTGCTGGCAACGATGACATTGTTATGCTGAAGGCCGAAGATAGTAGCGATTGCGTCACATTAATGTTCGAAAACCCTTGTGAGTAA SCRFGLFLLRSEGFEHYRCDRNISMGMNLNNMAKMLRCAGNDDIVMLKAEDSSDCVTLMFENPCE Homology
BLAST of Lcy11g016210 vs. ExPASy Swiss-Prot
Match: P17070 (Proliferating cell nuclear antigen OS=Oryza sativa subsp. japonica OX=39947 GN=Os02g0805200 PE=1 SV=2) HSP 1 Score: 105.1 bits (261), Expect = 3.0e-22 Identity = 47/56 (83.93%), Postives = 52/56 (92.86%), Query Frame = 0
BLAST of Lcy11g016210 vs. ExPASy Swiss-Prot
Match: P22177 (Proliferating cell nuclear antigen (Fragment) OS=Glycine max OX=3847 PE=2 SV=1) HSP 1 Score: 105.1 bits (261), Expect = 3.0e-22 Identity = 47/58 (81.03%), Postives = 53/58 (91.38%), Query Frame = 0
BLAST of Lcy11g016210 vs. ExPASy Swiss-Prot
Match: O82134 (Proliferating cell nuclear antigen OS=Pisum sativum OX=3888 GN=PCNA PE=2 SV=1) HSP 1 Score: 104.4 bits (259), Expect = 5.0e-22 Identity = 46/58 (79.31%), Postives = 53/58 (91.38%), Query Frame = 0
BLAST of Lcy11g016210 vs. ExPASy Swiss-Prot
Match: Q43266 (Proliferating cell nuclear antigen OS=Zea mays OX=4577 GN=PCNA PE=2 SV=1) HSP 1 Score: 104.0 bits (258), Expect = 6.6e-22 Identity = 46/56 (82.14%), Postives = 52/56 (92.86%), Query Frame = 0
BLAST of Lcy11g016210 vs. ExPASy Swiss-Prot
Match: P24314 (Proliferating cell nuclear antigen OS=Catharanthus roseus OX=4058 PE=2 SV=1) HSP 1 Score: 103.2 bits (256), Expect = 1.1e-21 Identity = 47/58 (81.03%), Postives = 52/58 (89.66%), Query Frame = 0
BLAST of Lcy11g016210 vs. ExPASy TrEMBL
Match: A0A6J1K7Q7 (Proliferating cell nuclear antigen OS=Cucurbita maxima OX=3661 GN=LOC111491393 PE=3 SV=1) HSP 1 Score: 112.5 bits (280), Expect = 6.8e-22 Identity = 50/58 (86.21%), Postives = 54/58 (93.10%), Query Frame = 0
BLAST of Lcy11g016210 vs. ExPASy TrEMBL
Match: A0A6J1FVS4 (Proliferating cell nuclear antigen OS=Cucurbita moschata OX=3662 GN=LOC111447316 PE=3 SV=1) HSP 1 Score: 112.5 bits (280), Expect = 6.8e-22 Identity = 50/58 (86.21%), Postives = 54/58 (93.10%), Query Frame = 0
BLAST of Lcy11g016210 vs. ExPASy TrEMBL
Match: A0A6J1DUY3 (Proliferating cell nuclear antigen OS=Momordica charantia OX=3673 GN=LOC111023729 PE=3 SV=1) HSP 1 Score: 107.8 bits (268), Expect = 1.7e-20 Identity = 48/58 (82.76%), Postives = 53/58 (91.38%), Query Frame = 0
BLAST of Lcy11g016210 vs. ExPASy TrEMBL
Match: A0A199VS92 (Proliferating cell nuclear antigen OS=Ananas comosus OX=4615 GN=LOC109723678 PE=3 SV=1) HSP 1 Score: 105.9 bits (263), Expect = 6.4e-20 Identity = 48/56 (85.71%), Postives = 52/56 (92.86%), Query Frame = 0
BLAST of Lcy11g016210 vs. ExPASy TrEMBL
Match: A0A6V7QT21 (Proliferating cell nuclear antigen OS=Ananas comosus var. bracteatus OX=296719 GN=CB5_LOCUS29603 PE=3 SV=1) HSP 1 Score: 105.9 bits (263), Expect = 6.4e-20 Identity = 48/56 (85.71%), Postives = 52/56 (92.86%), Query Frame = 0
BLAST of Lcy11g016210 vs. NCBI nr
Match: XP_022942180.1 (proliferating cell nuclear antigen-like [Cucurbita moschata]) HSP 1 Score: 112.5 bits (280), Expect = 1.4e-21 Identity = 50/58 (86.21%), Postives = 54/58 (93.10%), Query Frame = 0
BLAST of Lcy11g016210 vs. NCBI nr
Match: XP_022996079.1 (proliferating cell nuclear antigen-like [Cucurbita maxima]) HSP 1 Score: 112.5 bits (280), Expect = 1.4e-21 Identity = 50/58 (86.21%), Postives = 54/58 (93.10%), Query Frame = 0
BLAST of Lcy11g016210 vs. NCBI nr
Match: KAG6600018.1 (Proliferating cell nuclear antigen, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 112.5 bits (280), Expect = 1.4e-21 Identity = 50/58 (86.21%), Postives = 54/58 (93.10%), Query Frame = 0
BLAST of Lcy11g016210 vs. NCBI nr
Match: XP_023549127.1 (proliferating cell nuclear antigen-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 112.5 bits (280), Expect = 1.4e-21 Identity = 50/58 (86.21%), Postives = 54/58 (93.10%), Query Frame = 0
BLAST of Lcy11g016210 vs. NCBI nr
Match: XP_038891866.1 (proliferating cell nuclear antigen-like [Benincasa hispida]) HSP 1 Score: 111.3 bits (277), Expect = 3.1e-21 Identity = 51/58 (87.93%), Postives = 54/58 (93.10%), Query Frame = 0
BLAST of Lcy11g016210 vs. TAIR 10
Match: AT2G29570.1 (proliferating cell nuclear antigen 2 ) HSP 1 Score: 100.9 bits (250), Expect = 4.0e-22 Identity = 44/58 (75.86%), Postives = 52/58 (89.66%), Query Frame = 0
BLAST of Lcy11g016210 vs. TAIR 10
Match: AT1G07370.1 (proliferating cellular nuclear antigen 1 ) HSP 1 Score: 99.4 bits (246), Expect = 1.2e-21 Identity = 43/58 (74.14%), Postives = 51/58 (87.93%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Sponge gourd (P93075) v1
Date Performed: 2021-12-06
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|