Lcy06g012070 (gene) Sponge gourd (P93075) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGCAGGTTTCTTTTCTTAGTGGTTTCACTCCTTGCCATCATGGCGGCGGTTGAGCCAAGAAATACTTTAGGAGTTGGCGCTGAAAAGAAACCTGAGATGGGTGGTTTCGAACCAATAAAGAACATAAGTGACCCAAGAATCCAAGGGCTGGGGCAAATCGCAGTGAAGGAATATAATAACCAAACCGGTTCTAATTTGTTCTTTCTGGGAGTGGTGGGTGGAAGGCTGCAAGTTGTCGAGGGAATCAACTACATCTTTTACTTAATCGCCACCGATGACATTTCAGTGAGCCTCTATAATGCCTTGGCGTTCGAGAACCTCGACAAGGAGCTCATCCTCTACGACTTTTATGACGTCCCCTTTTGCCGTCTGCAAGCACAAGCTTAG ATGGGCAGGTTTCTTTTCTTAGTGGTTTCACTCCTTGCCATCATGGCGGCGGTTGAGCCAAGAAATACTTTAGGAGTTGGCGCTGAAAAGAAACCTGAGATGGGTGGTTTCGAACCAATAAAGAACATAAGTGACCCAAGAATCCAAGGGCTGGGGCAAATCGCAGTGAAGGAATATAATAACCAAACCGGTTCTAATTTGTTCTTTCTGGGAGTGGTGGGTGGAAGGCTGCAAGTTGTCGAGGGAATCAACTACATCTTTTACTTAATCGCCACCGATGACATTTCAGTGAGCCTCTATAATGCCTTGGCGTTCGAGAACCTCGACAAGGAGCTCATCCTCTACGACTTTTATGACGTCCCCTTTTGCCGTCTGCAAGCACAAGCTTAG ATGGGCAGGTTTCTTTTCTTAGTGGTTTCACTCCTTGCCATCATGGCGGCGGTTGAGCCAAGAAATACTTTAGGAGTTGGCGCTGAAAAGAAACCTGAGATGGGTGGTTTCGAACCAATAAAGAACATAAGTGACCCAAGAATCCAAGGGCTGGGGCAAATCGCAGTGAAGGAATATAATAACCAAACCGGTTCTAATTTGTTCTTTCTGGGAGTGGTGGGTGGAAGGCTGCAAGTTGTCGAGGGAATCAACTACATCTTTTACTTAATCGCCACCGATGACATTTCAGTGAGCCTCTATAATGCCTTGGCGTTCGAGAACCTCGACAAGGAGCTCATCCTCTACGACTTTTATGACGTCCCCTTTTGCCGTCTGCAAGCACAAGCTTAG MGRFLFLVVSLLAIMAAVEPRNTLGVGAEKKPEMGGFEPIKNISDPRIQGLGQIAVKEYNNQTGSNLFFLGVVGGRLQVVEGINYIFYLIATDDISVSLYNALAFENLDKELILYDFYDVPFCRLQAQA Homology
BLAST of Lcy06g012070 vs. ExPASy Swiss-Prot
Match: P86472 (Cysteine proteinase inhibitor 1 OS=Actinidia chinensis var. chinensis OX=1590841 GN=CYT1 PE=1 SV=2) HSP 1 Score: 62.0 bits (149), Expect = 5.7e-09 Identity = 37/100 (37.00%), Postives = 53/100 (53.00%), Query Frame = 0
BLAST of Lcy06g012070 vs. ExPASy Swiss-Prot
Match: Q41916 (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana OX=3702 GN=CYS5 PE=2 SV=2) HSP 1 Score: 59.7 bits (143), Expect = 2.8e-08 Identity = 37/94 (39.36%), Postives = 50/94 (53.19%), Query Frame = 0
BLAST of Lcy06g012070 vs. ExPASy Swiss-Prot
Match: Q10J94 (Cysteine proteinase inhibitor 8 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0429000 PE=2 SV=1) HSP 1 Score: 53.9 bits (128), Expect = 1.5e-06 Identity = 37/107 (34.58%), Postives = 56/107 (52.34%), Query Frame = 0
BLAST of Lcy06g012070 vs. ExPASy Swiss-Prot
Match: Q10Q46 (Cysteine proteinase inhibitor 6 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0210200 PE=3 SV=1) HSP 1 Score: 51.6 bits (122), Expect = 7.7e-06 Identity = 37/88 (42.05%), Postives = 51/88 (57.95%), Query Frame = 0
BLAST of Lcy06g012070 vs. ExPASy Swiss-Prot
Match: Q84WT8 (Cysteine proteinase inhibitor 4 OS=Arabidopsis thaliana OX=3702 GN=CYS4 PE=3 SV=2) HSP 1 Score: 49.7 bits (117), Expect = 2.9e-05 Identity = 36/109 (33.03%), Postives = 56/109 (51.38%), Query Frame = 0
BLAST of Lcy06g012070 vs. ExPASy TrEMBL
Match: A0A6J1IGE9 (cysteine proteinase inhibitor 1-like OS=Cucurbita maxima OX=3661 GN=LOC111474507 PE=4 SV=1) HSP 1 Score: 84.0 bits (206), Expect = 5.2e-13 Identity = 45/121 (37.19%), Postives = 70/121 (57.85%), Query Frame = 0
BLAST of Lcy06g012070 vs. ExPASy TrEMBL
Match: A0A6J1EMY2 (cysteine proteinase inhibitor 1-like OS=Cucurbita moschata OX=3662 GN=LOC111434041 PE=4 SV=1) HSP 1 Score: 82.4 bits (202), Expect = 1.5e-12 Identity = 47/120 (39.17%), Postives = 69/120 (57.50%), Query Frame = 0
BLAST of Lcy06g012070 vs. ExPASy TrEMBL
Match: A0A6J1IIS7 (cysteine proteinase inhibitor 1-like OS=Cucurbita maxima OX=3661 GN=LOC111474432 PE=4 SV=1) HSP 1 Score: 82.0 bits (201), Expect = 2.0e-12 Identity = 46/121 (38.02%), Postives = 68/121 (56.20%), Query Frame = 0
BLAST of Lcy06g012070 vs. ExPASy TrEMBL
Match: A0A6J1IJX9 (cysteine proteinase inhibitor 1-like OS=Cucurbita maxima OX=3661 GN=LOC111475533 PE=4 SV=1) HSP 1 Score: 78.2 bits (191), Expect = 2.8e-11 Identity = 43/120 (35.83%), Postives = 68/120 (56.67%), Query Frame = 0
BLAST of Lcy06g012070 vs. ExPASy TrEMBL
Match: A0A6J1CM53 (cysteine proteinase inhibitor 1-like OS=Momordica charantia OX=3673 GN=LOC111012731 PE=4 SV=1) HSP 1 Score: 77.4 bits (189), Expect = 4.8e-11 Identity = 46/118 (38.98%), Postives = 68/118 (57.63%), Query Frame = 0
BLAST of Lcy06g012070 vs. NCBI nr
Match: XP_023520261.1 (cysteine proteinase inhibitor 1-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 86.3 bits (212), Expect = 2.1e-13 Identity = 47/121 (38.84%), Postives = 70/121 (57.85%), Query Frame = 0
BLAST of Lcy06g012070 vs. NCBI nr
Match: XP_023520245.1 (cysteine proteinase inhibitor 1-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 86.3 bits (212), Expect = 2.1e-13 Identity = 47/121 (38.84%), Postives = 71/121 (58.68%), Query Frame = 0
BLAST of Lcy06g012070 vs. NCBI nr
Match: XP_022975330.1 (cysteine proteinase inhibitor 1-like [Cucurbita maxima]) HSP 1 Score: 84.0 bits (206), Expect = 1.1e-12 Identity = 45/121 (37.19%), Postives = 70/121 (57.85%), Query Frame = 0
BLAST of Lcy06g012070 vs. NCBI nr
Match: XP_023520258.1 (cysteine proteinase inhibitor 1-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 82.8 bits (203), Expect = 2.4e-12 Identity = 46/121 (38.02%), Postives = 69/121 (57.02%), Query Frame = 0
BLAST of Lcy06g012070 vs. NCBI nr
Match: XP_023520817.1 (cysteine proteinase inhibitor 1-like [Cucurbita pepo subsp. pepo] >XP_023521297.1 cysteine proteinase inhibitor 1-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 82.4 bits (202), Expect = 3.1e-12 Identity = 45/121 (37.19%), Postives = 68/121 (56.20%), Query Frame = 0
BLAST of Lcy06g012070 vs. TAIR 10
Match: AT5G47550.1 (Cystatin/monellin superfamily protein ) HSP 1 Score: 59.7 bits (143), Expect = 2.0e-09 Identity = 37/94 (39.36%), Postives = 50/94 (53.19%), Query Frame = 0
BLAST of Lcy06g012070 vs. TAIR 10
Match: AT4G16500.1 (Cystatin/monellin superfamily protein ) HSP 1 Score: 49.7 bits (117), Expect = 2.1e-06 Identity = 36/109 (33.03%), Postives = 56/109 (51.38%), Query Frame = 0
BLAST of Lcy06g012070 vs. TAIR 10
Match: AT2G20620.1 (Protein of unknown function (DUF626) ) HSP 1 Score: 44.3 bits (103), Expect = 8.7e-05 Identity = 29/81 (35.80%), Postives = 44/81 (54.32%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Sponge gourd (P93075) v1
Date Performed: 2021-12-06
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|