
Lcy05g017150 (gene) Sponge gourd (P93075) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGACAATGTCAGATATCCTATCATCATCGATCAAAATTACTTCCCCCACAATAAAGATTGTCCTGGACAGGTGCGTATTGATATCTATACAACTATATATATATATATATCAAAGGATAGATCTAAACTAAACTTTTATATTTTGTTTCTTCACATTGAATAGGCTTCTAGAATTAAAGTTAGTGATGTGACATATGAAGATATCCATGGGACATTAGCCAAACAGGTTGTCATGAAATTTGATTGTAGCCCAAAGTTTCCTTGCATGGGGATAAAGTTGGAAGATGTAAAGCTGACTTACAAGAATGGAGTAGCCAAATGCTCGAGGAACTGTTGTTGGCTTGGTTCAACCAATGAGTTGTTTTTAGGAAATTTTTAA ATGGACAATGTCAGATATCCTATCATCATCGATCAAAATTACTTCCCCCACAATAAAGATTGTCCTGGACAGGCTTCTAGAATTAAAGTTAGTGATGTGACATATGAAGATATCCATGGGACATTAGCCAAACAGGTTGTCATGAAATTTGATTGTAGCCCAAAGTTTCCTTGCATGGGGATAAAGTTGGAAGATGTAAAGCTGACTTACAAGAATGGAGTAGCCAAATGCTCGAGGAACTGTTGTTGGCTTGGTTCAACCAATGAGTTGTTTTTAGGAAATTTTTAA ATGGACAATGTCAGATATCCTATCATCATCGATCAAAATTACTTCCCCCACAATAAAGATTGTCCTGGACAGGCTTCTAGAATTAAAGTTAGTGATGTGACATATGAAGATATCCATGGGACATTAGCCAAACAGGTTGTCATGAAATTTGATTGTAGCCCAAAGTTTCCTTGCATGGGGATAAAGTTGGAAGATGTAAAGCTGACTTACAAGAATGGAGTAGCCAAATGCTCGAGGAACTGTTGTTGGCTTGGTTCAACCAATGAGTTGTTTTTAGGAAATTTTTAA MDNVRYPIIIDQNYFPHNKDCPGQASRIKVSDVTYEDIHGTLAKQVVMKFDCSPKFPCMGIKLEDVKLTYKNGVAKCSRNCCWLGSTNELFLGNF Homology
BLAST of Lcy05g017150 vs. ExPASy Swiss-Prot
Match: P48979 (Polygalacturonase OS=Prunus persica OX=3760 PE=2 SV=1) HSP 1 Score: 118.6 bits (296), Expect = 3.8e-26 Identity = 56/89 (62.92%), Postives = 64/89 (71.91%), Query Frame = 0
BLAST of Lcy05g017150 vs. ExPASy Swiss-Prot
Match: P35336 (Polygalacturonase OS=Actinidia deliciosa OX=3627 PE=2 SV=1) HSP 1 Score: 86.3 bits (212), Expect = 2.1e-16 Identity = 39/75 (52.00%), Postives = 49/75 (65.33%), Query Frame = 0
BLAST of Lcy05g017150 vs. ExPASy Swiss-Prot
Match: P05117 (Polygalacturonase-2 OS=Solanum lycopersicum OX=4081 GN=PG2 PE=1 SV=1) HSP 1 Score: 80.5 bits (197), Expect = 1.1e-14 Identity = 36/73 (49.32%), Postives = 50/73 (68.49%), Query Frame = 0
BLAST of Lcy05g017150 vs. ExPASy Swiss-Prot
Match: O22818 (Probable polygalacturonase At2g43860 OS=Arabidopsis thaliana OX=3702 GN=At2g43860 PE=2 SV=1) HSP 1 Score: 77.0 bits (188), Expect = 1.3e-13 Identity = 39/78 (50.00%), Postives = 50/78 (64.10%), Query Frame = 0
BLAST of Lcy05g017150 vs. ExPASy Swiss-Prot
Match: O23147 (Polygalacturonase ADPG1 OS=Arabidopsis thaliana OX=3702 GN=ADPG1 PE=2 SV=1) HSP 1 Score: 76.3 bits (186), Expect = 2.1e-13 Identity = 37/77 (48.05%), Postives = 51/77 (66.23%), Query Frame = 0
BLAST of Lcy05g017150 vs. ExPASy TrEMBL
Match: J9WQT5 (PG2 (Fragment) OS=Cucurbita pepo subsp. pepo OX=3664 PE=2 SV=1) HSP 1 Score: 134.0 bits (336), Expect = 3.2e-28 Identity = 59/76 (77.63%), Postives = 66/76 (86.84%), Query Frame = 0
BLAST of Lcy05g017150 vs. ExPASy TrEMBL
Match: A0A6J1GNK7 (polygalacturonase-like OS=Cucurbita moschata OX=3662 GN=LOC111455565 PE=3 SV=1) HSP 1 Score: 131.0 bits (328), Expect = 2.7e-27 Identity = 59/76 (77.63%), Postives = 65/76 (85.53%), Query Frame = 0
BLAST of Lcy05g017150 vs. ExPASy TrEMBL
Match: A0A6J1GMA1 (polygalacturonase-like OS=Cucurbita moschata OX=3662 GN=LOC111455564 PE=3 SV=1) HSP 1 Score: 131.0 bits (328), Expect = 2.7e-27 Identity = 59/76 (77.63%), Postives = 65/76 (85.53%), Query Frame = 0
BLAST of Lcy05g017150 vs. ExPASy TrEMBL
Match: A0A6J1I881 (polygalacturonase-like OS=Cucurbita maxima OX=3661 GN=LOC111470566 PE=3 SV=1) HSP 1 Score: 129.8 bits (325), Expect = 6.0e-27 Identity = 58/76 (76.32%), Postives = 65/76 (85.53%), Query Frame = 0
BLAST of Lcy05g017150 vs. ExPASy TrEMBL
Match: A0A1S2YIL9 (polygalacturonase-like OS=Cicer arietinum OX=3827 GN=LOC101509102 PE=3 SV=1) HSP 1 Score: 129.8 bits (325), Expect = 6.0e-27 Identity = 59/80 (73.75%), Postives = 68/80 (85.00%), Query Frame = 0
BLAST of Lcy05g017150 vs. NCBI nr
Match: XP_023511587.1 (polygalacturonase-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 134.0 bits (336), Expect = 6.6e-28 Identity = 59/76 (77.63%), Postives = 66/76 (86.84%), Query Frame = 0
BLAST of Lcy05g017150 vs. NCBI nr
Match: AFS18538.1 (PG2, partial [Cucurbita pepo subsp. pepo]) HSP 1 Score: 134.0 bits (336), Expect = 6.6e-28 Identity = 59/76 (77.63%), Postives = 66/76 (86.84%), Query Frame = 0
BLAST of Lcy05g017150 vs. NCBI nr
Match: XP_023511588.1 (polygalacturonase-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 132.1 bits (331), Expect = 2.5e-27 Identity = 59/76 (77.63%), Postives = 65/76 (85.53%), Query Frame = 0
BLAST of Lcy05g017150 vs. NCBI nr
Match: XP_022953043.1 (polygalacturonase-like [Cucurbita moschata]) HSP 1 Score: 131.0 bits (328), Expect = 5.6e-27 Identity = 59/76 (77.63%), Postives = 65/76 (85.53%), Query Frame = 0
BLAST of Lcy05g017150 vs. NCBI nr
Match: XP_022953045.1 (polygalacturonase-like [Cucurbita moschata]) HSP 1 Score: 131.0 bits (328), Expect = 5.6e-27 Identity = 59/76 (77.63%), Postives = 65/76 (85.53%), Query Frame = 0
BLAST of Lcy05g017150 vs. TAIR 10
Match: AT3G59850.1 (Pectin lyase-like superfamily protein ) HSP 1 Score: 103.6 bits (257), Expect = 8.9e-23 Identity = 48/91 (52.75%), Postives = 64/91 (70.33%), Query Frame = 0
BLAST of Lcy05g017150 vs. TAIR 10
Match: AT2G43870.1 (Pectin lyase-like superfamily protein ) HSP 1 Score: 98.6 bits (244), Expect = 2.9e-21 Identity = 47/72 (65.28%), Postives = 55/72 (76.39%), Query Frame = 0
BLAST of Lcy05g017150 vs. TAIR 10
Match: AT1G05650.1 (Pectin lyase-like superfamily protein ) HSP 1 Score: 90.1 bits (222), Expect = 1.0e-18 Identity = 41/78 (52.56%), Postives = 51/78 (65.38%), Query Frame = 0
BLAST of Lcy05g017150 vs. TAIR 10
Match: AT1G05660.1 (Pectin lyase-like superfamily protein ) HSP 1 Score: 90.1 bits (222), Expect = 1.0e-18 Identity = 41/78 (52.56%), Postives = 50/78 (64.10%), Query Frame = 0
BLAST of Lcy05g017150 vs. TAIR 10
Match: AT1G65570.1 (Pectin lyase-like superfamily protein ) HSP 1 Score: 87.8 bits (216), Expect = 5.1e-18 Identity = 39/78 (50.00%), Postives = 50/78 (64.10%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Sponge gourd (P93075) v1
Date Performed: 2021-12-06 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|