
Lcy05g015820 (gene) Sponge gourd (P93075) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTGAACCTCTTGAAACTCGTCATTGCTACATCTTTTCTAGCTCTCATCTTCTCATCCAAGATTGAAGCAAGGCCAAGCCCTAGAATGAGTCTAGCGACACGACTAAAGTTGGATGGTGAGACATCAGATTGTTGGGGATCTCTATACCAACTCCAAGCATGCACCGCAGAAATTATCACATTCTTCCTCAATGGTGAAACTTATTTAGGCCCCAACTGTTGTGAAGCCATCAAAATCATCCAACATGAATGTTGGCCTACGTTGCTTGGCTCTTTGGGATACACAACTGAAGAAGGTAACATCCTTGAAACCTATTGTGATACCACGATTGATACACTTTTGACATCATCATCTTCTCAGTTGGCAGTGGCACCATCCATTGAGCAAAAGAATGAGCCTAAAAGCTTCGCTCCCTGA ATGGTGAACCTCTTGAAACTCGTCATTGCTACATCTTTTCTAGCTCTCATCTTCTCATCCAAGATTGAAGCAAGGCCAAGCCCTAGAATGAGTCTAGCGACACGACTAAAGTTGGATGGTGAGACATCAGATTGTTGGGGATCTCTATACCAACTCCAAGCATGCACCGCAGAAATTATCACATTCTTCCTCAATGGTGAAACTTATTTAGGCCCCAACTGTTGTGAAGCCATCAAAATCATCCAACATGAATGTTGGCCTACGTTGCTTGGCTCTTTGGGATACACAACTGAAGAAGGTAACATCCTTGAAACCTATTGTGATACCACGATTGATACACTTTTGACATCATCATCTTCTCAGTTGGCAGTGGCACCATCCATTGAGCAAAAGAATGAGCCTAAAAGCTTCGCTCCCTGA ATGGTGAACCTCTTGAAACTCGTCATTGCTACATCTTTTCTAGCTCTCATCTTCTCATCCAAGATTGAAGCAAGGCCAAGCCCTAGAATGAGTCTAGCGACACGACTAAAGTTGGATGGTGAGACATCAGATTGTTGGGGATCTCTATACCAACTCCAAGCATGCACCGCAGAAATTATCACATTCTTCCTCAATGGTGAAACTTATTTAGGCCCCAACTGTTGTGAAGCCATCAAAATCATCCAACATGAATGTTGGCCTACGTTGCTTGGCTCTTTGGGATACACAACTGAAGAAGGTAACATCCTTGAAACCTATTGTGATACCACGATTGATACACTTTTGACATCATCATCTTCTCAGTTGGCAGTGGCACCATCCATTGAGCAAAAGAATGAGCCTAAAAGCTTCGCTCCCTGA MVNLLKLVIATSFLALIFSSKIEARPSPRMSLATRLKLDGETSDCWGSLYQLQACTAEIITFFLNGETYLGPNCCEAIKIIQHECWPTLLGSLGYTTEEGNILETYCDTTIDTLLTSSSSQLAVAPSIEQKNEPKSFAP Homology
BLAST of Lcy05g015820 vs. ExPASy Swiss-Prot
Match: Q9SRD8 (Egg cell-secreted protein 1.1 OS=Arabidopsis thaliana OX=3702 GN=EC1.1 PE=2 SV=1) HSP 1 Score: 121.3 bits (303), Expect = 8.5e-27 Identity = 54/106 (50.94%), Postives = 72/106 (67.92%), Query Frame = 0
BLAST of Lcy05g015820 vs. ExPASy Swiss-Prot
Match: Q9T039 (Egg cell-secreted protein 1.4 OS=Arabidopsis thaliana OX=3702 GN=EC1.4 PE=2 SV=1) HSP 1 Score: 97.8 bits (242), Expect = 1.0e-19 Identity = 51/129 (39.53%), Postives = 73/129 (56.59%), Query Frame = 0
BLAST of Lcy05g015820 vs. ExPASy Swiss-Prot
Match: Q9SJ24 (Egg cell-secreted protein 1.2 OS=Arabidopsis thaliana OX=3702 GN=EC1.2 PE=2 SV=1) HSP 1 Score: 97.4 bits (241), Expect = 1.3e-19 Identity = 46/107 (42.99%), Postives = 69/107 (64.49%), Query Frame = 0
BLAST of Lcy05g015820 vs. ExPASy Swiss-Prot
Match: Q9SJ23 (Egg cell-secreted protein 1.3 OS=Arabidopsis thaliana OX=3702 GN=EC1.3 PE=2 SV=1) HSP 1 Score: 94.4 bits (233), Expect = 1.1e-18 Identity = 49/119 (41.18%), Postives = 68/119 (57.14%), Query Frame = 0
BLAST of Lcy05g015820 vs. ExPASy TrEMBL
Match: A0A6J1KEX2 (egg cell-secreted protein 1.1-like OS=Cucurbita maxima OX=3661 GN=LOC111493240 PE=4 SV=1) HSP 1 Score: 227.3 bits (578), Expect = 4.1e-56 Identity = 111/140 (79.29%), Postives = 124/140 (88.57%), Query Frame = 0
BLAST of Lcy05g015820 vs. ExPASy TrEMBL
Match: A0A6J1KD37 (egg cell-secreted protein 1.1-like OS=Cucurbita maxima OX=3661 GN=LOC111493241 PE=4 SV=1) HSP 1 Score: 222.2 bits (565), Expect = 1.3e-54 Identity = 110/140 (78.57%), Postives = 121/140 (86.43%), Query Frame = 0
BLAST of Lcy05g015820 vs. ExPASy TrEMBL
Match: A0A0A0LSR4 (Prolamin_like domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_1G124020 PE=4 SV=1) HSP 1 Score: 199.1 bits (505), Expect = 1.2e-47 Identity = 98/142 (69.01%), Postives = 118/142 (83.10%), Query Frame = 0
BLAST of Lcy05g015820 vs. ExPASy TrEMBL
Match: A0A1S3CM80 (egg cell-secreted protein 1.2-like OS=Cucumis melo OX=3656 GN=LOC103502392 PE=4 SV=1) HSP 1 Score: 191.0 bits (484), Expect = 3.2e-45 Identity = 94/135 (69.63%), Postives = 111/135 (82.22%), Query Frame = 0
BLAST of Lcy05g015820 vs. ExPASy TrEMBL
Match: A0A0A0LVH9 (Prolamin_like domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_1G124010 PE=4 SV=1) HSP 1 Score: 188.7 bits (478), Expect = 1.6e-44 Identity = 86/118 (72.88%), Postives = 101/118 (85.59%), Query Frame = 0
BLAST of Lcy05g015820 vs. NCBI nr
Match: XP_022998659.1 (egg cell-secreted protein 1.1-like [Cucurbita maxima]) HSP 1 Score: 227.3 bits (578), Expect = 8.4e-56 Identity = 111/140 (79.29%), Postives = 124/140 (88.57%), Query Frame = 0
BLAST of Lcy05g015820 vs. NCBI nr
Match: XP_023524587.1 (egg cell-secreted protein 1.1-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 227.3 bits (578), Expect = 8.4e-56 Identity = 112/140 (80.00%), Postives = 122/140 (87.14%), Query Frame = 0
BLAST of Lcy05g015820 vs. NCBI nr
Match: KAG6607143.1 (Egg cell-secreted protein 1.1, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 223.4 bits (568), Expect = 1.2e-54 Identity = 108/140 (77.14%), Postives = 122/140 (87.14%), Query Frame = 0
BLAST of Lcy05g015820 vs. NCBI nr
Match: XP_022998660.1 (egg cell-secreted protein 1.1-like [Cucurbita maxima]) HSP 1 Score: 222.2 bits (565), Expect = 2.7e-54 Identity = 110/140 (78.57%), Postives = 121/140 (86.43%), Query Frame = 0
BLAST of Lcy05g015820 vs. NCBI nr
Match: XP_023524588.1 (egg cell-secreted protein 1.1-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 221.1 bits (562), Expect = 6.0e-54 Identity = 107/140 (76.43%), Postives = 121/140 (86.43%), Query Frame = 0
BLAST of Lcy05g015820 vs. TAIR 10
Match: AT1G76750.1 (Protein of unknown function (DUF1278) ) HSP 1 Score: 121.3 bits (303), Expect = 6.1e-28 Identity = 54/106 (50.94%), Postives = 72/106 (67.92%), Query Frame = 0
BLAST of Lcy05g015820 vs. TAIR 10
Match: AT4G39340.1 (Protein of unknown function (DUF1278) ) HSP 1 Score: 97.8 bits (242), Expect = 7.2e-21 Identity = 51/129 (39.53%), Postives = 73/129 (56.59%), Query Frame = 0
BLAST of Lcy05g015820 vs. TAIR 10
Match: AT2G21740.1 (Protein of unknown function (DUF1278) ) HSP 1 Score: 97.4 bits (241), Expect = 9.4e-21 Identity = 46/107 (42.99%), Postives = 69/107 (64.49%), Query Frame = 0
BLAST of Lcy05g015820 vs. TAIR 10
Match: AT2G21750.1 (Protein of unknown function (DUF1278) ) HSP 1 Score: 94.4 bits (233), Expect = 7.9e-20 Identity = 49/119 (41.18%), Postives = 68/119 (57.14%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Sponge gourd (P93075) v1
Date Performed: 2021-12-06 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|