Lcy05g015790 (gene) Sponge gourd (P93075) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCCCACTTCATCTTCACATCTTTTCTAGCTCTCTTCTTTTCATTCATGATAGAATCAAGTCCAAACCCTAAAACGAGCTTGACAACACGATTGAAGTTAGAAGGTGATACAACGGATTGTTGGAGATCTTTGTTTGAACTTCGAGCATGCACCGGTGAAATTATCACATTCTTCCTCAATAGTGAAACTAACTTAAGCTCCAATTGTTGTCAAGCTATGAGAGTCATTCAACATGAGTGTTGGCCTACATTGCTTGGCTCTTTGGGATACATGGTCGAAGAAGGTGACATCCTGGAAACCTATTGTGATACTACTGATGATTCTCCCCCAACATTACCGTCTCCTCCAACACCACTATCTGTCATGCAAACGATTGGGTTAATACACCTCACTCCATAA ATGGCCCACTTCATCTTCACATCTTTTCTAGCTCTCTTCTTTTCATTCATGATAGAATCAAGTCCAAACCCTAAAACGAGCTTGACAACACGATTGAAGTTAGAAGGTGATACAACGGATTGTTGGAGATCTTTGTTTGAACTTCGAGCATGCACCGGTGAAATTATCACATTCTTCCTCAATAGTGAAACTAACTTAAGCTCCAATTGTTGTCAAGCTATGAGAGTCATTCAACATGAGTGTTGGCCTACATTGCTTGGCTCTTTGGGATACATGGTCGAAGAAGGTGACATCCTGGAAACCTATTGTGATACTACTGATGATTCTCCCCCAACATTACCGTCTCCTCCAACACCACTATCTGTCATGCAAACGATTGGGTTAATACACCTCACTCCATAA ATGGCCCACTTCATCTTCACATCTTTTCTAGCTCTCTTCTTTTCATTCATGATAGAATCAAGTCCAAACCCTAAAACGAGCTTGACAACACGATTGAAGTTAGAAGGTGATACAACGGATTGTTGGAGATCTTTGTTTGAACTTCGAGCATGCACCGGTGAAATTATCACATTCTTCCTCAATAGTGAAACTAACTTAAGCTCCAATTGTTGTCAAGCTATGAGAGTCATTCAACATGAGTGTTGGCCTACATTGCTTGGCTCTTTGGGATACATGGTCGAAGAAGGTGACATCCTGGAAACCTATTGTGATACTACTGATGATTCTCCCCCAACATTACCGTCTCCTCCAACACCACTATCTGTCATGCAAACGATTGGGTTAATACACCTCACTCCATAA MAHFIFTSFLALFFSFMIESSPNPKTSLTTRLKLEGDTTDCWRSLFELRACTGEIITFFLNSETNLSSNCCQAMRVIQHECWPTLLGSLGYMVEEGDILETYCDTTDDSPPTLPSPPTPLSVMQTIGLIHLTP Homology
BLAST of Lcy05g015790 vs. ExPASy Swiss-Prot
Match: Q9SRD8 (Egg cell-secreted protein 1.1 OS=Arabidopsis thaliana OX=3702 GN=EC1.1 PE=2 SV=1) HSP 1 Score: 104.4 bits (259), Expect = 1.0e-21 Identity = 56/135 (41.48%), Postives = 76/135 (56.30%), Query Frame = 0
BLAST of Lcy05g015790 vs. ExPASy Swiss-Prot
Match: Q9SJ24 (Egg cell-secreted protein 1.2 OS=Arabidopsis thaliana OX=3702 GN=EC1.2 PE=2 SV=1) HSP 1 Score: 89.4 bits (220), Expect = 3.4e-17 Identity = 47/122 (38.52%), Postives = 70/122 (57.38%), Query Frame = 0
BLAST of Lcy05g015790 vs. ExPASy Swiss-Prot
Match: Q9T039 (Egg cell-secreted protein 1.4 OS=Arabidopsis thaliana OX=3702 GN=EC1.4 PE=2 SV=1) HSP 1 Score: 88.2 bits (217), Expect = 7.6e-17 Identity = 40/93 (43.01%), Postives = 60/93 (64.52%), Query Frame = 0
BLAST of Lcy05g015790 vs. ExPASy Swiss-Prot
Match: Q9SJ23 (Egg cell-secreted protein 1.3 OS=Arabidopsis thaliana OX=3702 GN=EC1.3 PE=2 SV=1) HSP 1 Score: 84.3 bits (207), Expect = 1.1e-15 Identity = 39/90 (43.33%), Postives = 56/90 (62.22%), Query Frame = 0
BLAST of Lcy05g015790 vs. ExPASy TrEMBL
Match: A0A1S3CM80 (egg cell-secreted protein 1.2-like OS=Cucumis melo OX=3656 GN=LOC103502392 PE=4 SV=1) HSP 1 Score: 168.3 bits (425), Expect = 2.1e-38 Identity = 83/120 (69.17%), Postives = 96/120 (80.00%), Query Frame = 0
BLAST of Lcy05g015790 vs. ExPASy TrEMBL
Match: A0A0A0LSR4 (Prolamin_like domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_1G124020 PE=4 SV=1) HSP 1 Score: 165.6 bits (418), Expect = 1.4e-37 Identity = 76/104 (73.08%), Postives = 86/104 (82.69%), Query Frame = 0
BLAST of Lcy05g015790 vs. ExPASy TrEMBL
Match: A0A0A0LVH9 (Prolamin_like domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_1G124010 PE=4 SV=1) HSP 1 Score: 156.0 bits (393), Expect = 1.1e-34 Identity = 72/108 (66.67%), Postives = 86/108 (79.63%), Query Frame = 0
BLAST of Lcy05g015790 vs. ExPASy TrEMBL
Match: A0A6J1KEX2 (egg cell-secreted protein 1.1-like OS=Cucurbita maxima OX=3661 GN=LOC111493240 PE=4 SV=1) HSP 1 Score: 152.5 bits (384), Expect = 1.2e-33 Identity = 72/114 (63.16%), Postives = 85/114 (74.56%), Query Frame = 0
BLAST of Lcy05g015790 vs. ExPASy TrEMBL
Match: A0A5D3DE13 (Egg cell-secreted protein 1.2-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold991G00290 PE=4 SV=1) HSP 1 Score: 148.3 bits (373), Expect = 2.3e-32 Identity = 69/117 (58.97%), Postives = 85/117 (72.65%), Query Frame = 0
BLAST of Lcy05g015790 vs. NCBI nr
Match: XP_008464543.1 (PREDICTED: egg cell-secreted protein 1.2-like [Cucumis melo]) HSP 1 Score: 168.3 bits (425), Expect = 4.4e-38 Identity = 83/120 (69.17%), Postives = 96/120 (80.00%), Query Frame = 0
BLAST of Lcy05g015790 vs. NCBI nr
Match: XP_038895737.1 (egg cell-secreted protein 1.1-like [Benincasa hispida]) HSP 1 Score: 167.2 bits (422), Expect = 9.9e-38 Identity = 75/110 (68.18%), Postives = 91/110 (82.73%), Query Frame = 0
BLAST of Lcy05g015790 vs. NCBI nr
Match: XP_038895736.1 (egg cell-secreted protein 1.4-like [Benincasa hispida]) HSP 1 Score: 164.9 bits (416), Expect = 4.9e-37 Identity = 73/106 (68.87%), Postives = 88/106 (83.02%), Query Frame = 0
BLAST of Lcy05g015790 vs. NCBI nr
Match: XP_023551508.1 (egg cell-secreted protein 1.1 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 154.5 bits (389), Expect = 6.6e-34 Identity = 68/106 (64.15%), Postives = 84/106 (79.25%), Query Frame = 0
BLAST of Lcy05g015790 vs. NCBI nr
Match: XP_022998659.1 (egg cell-secreted protein 1.1-like [Cucurbita maxima]) HSP 1 Score: 152.5 bits (384), Expect = 2.5e-33 Identity = 72/114 (63.16%), Postives = 85/114 (74.56%), Query Frame = 0
BLAST of Lcy05g015790 vs. TAIR 10
Match: AT1G76750.1 (Protein of unknown function (DUF1278) ) HSP 1 Score: 104.4 bits (259), Expect = 7.3e-23 Identity = 56/135 (41.48%), Postives = 76/135 (56.30%), Query Frame = 0
BLAST of Lcy05g015790 vs. TAIR 10
Match: AT2G21740.1 (Protein of unknown function (DUF1278) ) HSP 1 Score: 89.4 bits (220), Expect = 2.4e-18 Identity = 47/122 (38.52%), Postives = 70/122 (57.38%), Query Frame = 0
BLAST of Lcy05g015790 vs. TAIR 10
Match: AT4G39340.1 (Protein of unknown function (DUF1278) ) HSP 1 Score: 88.2 bits (217), Expect = 5.4e-18 Identity = 40/93 (43.01%), Postives = 60/93 (64.52%), Query Frame = 0
BLAST of Lcy05g015790 vs. TAIR 10
Match: AT2G21750.1 (Protein of unknown function (DUF1278) ) HSP 1 Score: 84.3 bits (207), Expect = 7.8e-17 Identity = 39/90 (43.33%), Postives = 56/90 (62.22%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Sponge gourd (P93075) v1
Date Performed: 2021-12-06
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|