Lcy05g011730 (gene) Sponge gourd (P93075) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptidethree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCGAAGGATCTTGAAGTCGGTGGACTCGCGGCCAAAGACTACCAAGACCCACCTCTAGCCCCATTGATCGACGTCGATGAGTTCATTCAATGGTCTTTTTACAGAGCCATCATCGCCGAGTCCGTCGCCACGCTTTTGTTCTTGTACTTCACTGTTCTCGCCGTCATTGGCTACAGCAGCCAGTCCGACACTGAAAACGACGGCCAGATTTGCGGCGACATCGACATTCTCGGCATTGCTTGGGCATTTGGCGGCACAATCTTCGTTCTTATTTACTGCACCGCTGGGATTTCCGATGGGTTTAGTTATCTTCTATTGCTCTGTTTCTCTGTCTTTGTAGGAGGGCATATTAACCTGCCATACTCATTGTGAGAAACGACATACTCTGAGAGGGAACAAATAGAGAAGGAAAGAGAGATCTGGAGAGTGGAAACGAGGGGGACGGAAGAAAAAAACGTGAAGTCCAACAGTGACTTTACTGTTTAAGTCCCGACTTTGCAAAGTTAAAGTTCAGACATCCCAATTCATAGGCCCAAACACCGACTTTGGGGGAGTTAAAGAACTCCGGACTTAAAAAGTTGTAAGCCCAAACATGC ATGTCGAAGGATCTTGAAGTCGGTGGACTCGCGGCCAAAGACTACCAAGACCCACCTCTAGCCCCATTGATCGACGTCGATGAGTTCATTCAATGGTCTTTTTACAGAGCCATCATCGCCGAGTCCGTCGCCACGCTTTTGTTCTTGTACTTCACTGTTCTCGCCGTCATTGGCTACAGCAGCCAGTCCGACACTGAAAACGACGGCCAGATTTGCGGCGACATCGACATTCTCGGCATTGCTTGGGCATTTGGCGGCACAATCTTCGTTCTTATTTACTGCACCGCTGGGATTTCCGATGGGTTTAGTTATCTTCTATTGCTCTGTTTCTCTGTCTTTGTAGGAGGGCATATTAACCTGCCATACTCATTGTGAGAAACGACATACTCTGAGAGGGAACAAATAGAGAAGGAAAGAGAGATCTGGAGAGTGGAAACGAGGGGGACGGAAGAAAAAAACGTGAAGTCCAACAGTGACTTTACTGTTTAAGTCCCGACTTTGCAAAGTTAAAGTTCAGACATCCCAATTCATAGGCCCAAACACCGACTTTGGGGGAGTTAAAGAACTCCGGACTTAAAAAGTTGTAAGCCCAAACATGC ATGTCGAAGGATCTTGAAGTCGGTGGACTCGCGGCCAAAGACTACCAAGACCCACCTCTAGCCCCATTGATCGACGTCGATGAGTTCATTCAATGGTCTTTTTACAGAGCCATCATCGCCGAGTCCGTCGCCACGCTTTTGTTCTTGTACTTCACTGTTCTCGCCGTCATTGGCTACAGCAGCCAGTCCGACACTGAAAACGACGGCCAGATTTGCGGCGACATCGACATTCTCGGCATTGCTTGGGCATTTGGCGGCACAATCTTCGTTCTTATTTACTGCACCGCTGGGATTTCCGATGGGTTTAGTTATCTTCTATTGCTCTGTTTCTCTGTCTTTGTAGGAGGGCATATTAACCTGCCATACTCATTGTGA MSKDLEVGGLAAKDYQDPPLAPLIDVDEFIQWSFYRAIIAESVATLLFLYFTVLAVIGYSSQSDTENDGQICGDIDILGIAWAFGGTIFVLIYCTAGISDGFSYLLLLCFSVFVGGHINLPYSL Homology
BLAST of Lcy05g011730 vs. ExPASy Swiss-Prot
Match: P43286 (Aquaporin PIP2-1 OS=Arabidopsis thaliana OX=3702 GN=PIP2-1 PE=1 SV=1) HSP 1 Score: 136.7 bits (343), Expect = 1.7e-31 Identity = 73/127 (57.48%), Postives = 88/127 (69.29%), Query Frame = 0
BLAST of Lcy05g011730 vs. ExPASy Swiss-Prot
Match: P43287 (Aquaporin PIP2-2 OS=Arabidopsis thaliana OX=3702 GN=PIP2-2 PE=1 SV=2) HSP 1 Score: 133.7 bits (335), Expect = 1.5e-30 Identity = 65/102 (63.73%), Postives = 75/102 (73.53%), Query Frame = 0
BLAST of Lcy05g011730 vs. ExPASy Swiss-Prot
Match: P30302 (Aquaporin PIP2-3 OS=Arabidopsis thaliana OX=3702 GN=PIP2-3 PE=1 SV=1) HSP 1 Score: 132.1 bits (331), Expect = 4.3e-30 Identity = 64/102 (62.75%), Postives = 75/102 (73.53%), Query Frame = 0
BLAST of Lcy05g011730 vs. ExPASy Swiss-Prot
Match: Q9ATM6 (Aquaporin PIP2-4 OS=Zea mays OX=4577 GN=PIP2-4 PE=1 SV=1) HSP 1 Score: 132.1 bits (331), Expect = 4.3e-30 Identity = 66/108 (61.11%), Postives = 76/108 (70.37%), Query Frame = 0
BLAST of Lcy05g011730 vs. ExPASy Swiss-Prot
Match: Q9ATM4 (Aquaporin PIP2-7 OS=Zea mays OX=4577 GN=PIP2-7 PE=2 SV=1) HSP 1 Score: 130.6 bits (327), Expect = 1.3e-29 Identity = 72/129 (55.81%), Postives = 88/129 (68.22%), Query Frame = 0
BLAST of Lcy05g011730 vs. ExPASy TrEMBL
Match: A0A6J1ISY0 (aquaporin PIP2-2-like OS=Cucurbita maxima OX=3661 GN=LOC111478388 PE=3 SV=1) HSP 1 Score: 171.0 bits (432), Expect = 3.1e-39 Identity = 83/101 (82.18%), Postives = 87/101 (86.14%), Query Frame = 0
BLAST of Lcy05g011730 vs. ExPASy TrEMBL
Match: A0A6J1EJX2 (aquaporin PIP2-2-like OS=Cucurbita moschata OX=3662 GN=LOC111433285 PE=3 SV=1) HSP 1 Score: 168.7 bits (426), Expect = 1.5e-38 Identity = 82/101 (81.19%), Postives = 86/101 (85.15%), Query Frame = 0
BLAST of Lcy05g011730 vs. ExPASy TrEMBL
Match: V5RDW7 (Plasma intrinsic protein 2-3 OS=Cucumis sativus OX=3659 GN=PIP2-3 PE=2 SV=1) HSP 1 Score: 168.3 bits (425), Expect = 2.0e-38 Identity = 82/101 (81.19%), Postives = 86/101 (85.15%), Query Frame = 0
BLAST of Lcy05g011730 vs. ExPASy TrEMBL
Match: A0A1S3BL05 (aquaporin PIP2-2-like OS=Cucumis melo OX=3656 GN=LOC107990277 PE=3 SV=1) HSP 1 Score: 166.4 bits (420), Expect = 7.6e-38 Identity = 81/101 (80.20%), Postives = 86/101 (85.15%), Query Frame = 0
BLAST of Lcy05g011730 vs. ExPASy TrEMBL
Match: A3F571 (Aquaporin OS=Cucurbita ficifolia OX=37645 PE=2 SV=1) HSP 1 Score: 162.9 bits (411), Expect = 8.4e-37 Identity = 78/101 (77.23%), Postives = 84/101 (83.17%), Query Frame = 0
BLAST of Lcy05g011730 vs. NCBI nr
Match: XP_038880916.1 (aquaporin PIP2-2-like [Benincasa hispida]) HSP 1 Score: 172.2 bits (435), Expect = 2.9e-39 Identity = 84/101 (83.17%), Postives = 88/101 (87.13%), Query Frame = 0
BLAST of Lcy05g011730 vs. NCBI nr
Match: XP_022978378.1 (aquaporin PIP2-2-like [Cucurbita maxima]) HSP 1 Score: 171.0 bits (432), Expect = 6.4e-39 Identity = 83/101 (82.18%), Postives = 87/101 (86.14%), Query Frame = 0
BLAST of Lcy05g011730 vs. NCBI nr
Match: XP_023543139.1 (aquaporin PIP2-2-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 168.7 bits (426), Expect = 3.2e-38 Identity = 82/101 (81.19%), Postives = 86/101 (85.15%), Query Frame = 0
BLAST of Lcy05g011730 vs. NCBI nr
Match: XP_022926050.1 (aquaporin PIP2-2-like [Cucurbita moschata] >KAG6604426.1 Aquaporin PIP2-2, partial [Cucurbita argyrosperma subsp. sororia] >KAG7034572.1 Aquaporin PIP2-2, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 168.7 bits (426), Expect = 3.2e-38 Identity = 82/101 (81.19%), Postives = 86/101 (85.15%), Query Frame = 0
BLAST of Lcy05g011730 vs. NCBI nr
Match: NP_001292671.1 (aquaporin PIP2-2 [Cucumis sativus] >AHB33479.1 plasma intrinsic protein 2-3 [Cucumis sativus] >KGN48149.1 hypothetical protein Csa_002998 [Cucumis sativus]) HSP 1 Score: 168.3 bits (425), Expect = 4.1e-38 Identity = 82/101 (81.19%), Postives = 86/101 (85.15%), Query Frame = 0
BLAST of Lcy05g011730 vs. TAIR 10
Match: AT3G53420.1 (plasma membrane intrinsic protein 2A ) HSP 1 Score: 136.7 bits (343), Expect = 1.2e-32 Identity = 73/127 (57.48%), Postives = 88/127 (69.29%), Query Frame = 0
BLAST of Lcy05g011730 vs. TAIR 10
Match: AT3G53420.2 (plasma membrane intrinsic protein 2A ) HSP 1 Score: 136.7 bits (343), Expect = 1.2e-32 Identity = 73/127 (57.48%), Postives = 88/127 (69.29%), Query Frame = 0
BLAST of Lcy05g011730 vs. TAIR 10
Match: AT2G37170.1 (plasma membrane intrinsic protein 2 ) HSP 1 Score: 133.7 bits (335), Expect = 1.1e-31 Identity = 65/102 (63.73%), Postives = 75/102 (73.53%), Query Frame = 0
BLAST of Lcy05g011730 vs. TAIR 10
Match: AT2G37180.1 (Aquaporin-like superfamily protein ) HSP 1 Score: 132.1 bits (331), Expect = 3.1e-31 Identity = 64/102 (62.75%), Postives = 75/102 (73.53%), Query Frame = 0
BLAST of Lcy05g011730 vs. TAIR 10
Match: AT5G60660.1 (plasma membrane intrinsic protein 2;4 ) HSP 1 Score: 130.2 bits (326), Expect = 1.2e-30 Identity = 64/104 (61.54%), Postives = 78/104 (75.00%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Sponge gourd (P93075) v1
Date Performed: 2021-12-06
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|