Lcy01g015050 (gene) Sponge gourd (P93075) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCACTTCAACACAAGGCAACAACAACGGCTCTCCTCATCTTCTTCTTATTCTTTAAACACATTTTCATAGCTCTTGCAGACATCGGCACTGCCACAGCCTATGGTCCTCCATATCTTCGTAAGTAAAAACATTAAACACATATATCTCCATGTATTCAATCATATTAGTTGCATTAGTAATGATTTTCCCCCCAACAATGACGTTTAATTTGCAGCCACCCTGTGTAATGGGAACGACGTCTACCAATTCCCGCCTGGCAACCTCTTCGTGGCAGTCAACGAAGGACTATGGGACAACGGCGCTGCCTGCGGTCGACGATATAGATTACGATGTTTGAGTGGACGAAACCGTCCGTGCAAGACCGACATCATCGAAGTTCAGGTGGTGAACTTCTGTCCAAAGTCGCCATGCCCCTCTTCCTTTCTCATGTCCAAAGAAGCCTTTGCTGCCATCTCCCACCTCCCCAATGCTAGACTAAACGTCGAATACATTGAGTACGTAATCTTTTCTCCTTTTCCAAGTTAA ATGGCACTTCAACACAAGGCAACAACAACGGCTCTCCTCATCTTCTTCTTATTCTTTAAACACATTTTCATAGCTCTTGCAGACATCGGCACTGCCACAGCCTATGGTCCTCCATATCTTCCCACCCTGTGTAATGGGAACGACGTCTACCAATTCCCGCCTGGCAACCTCTTCGTGGCAGTCAACGAAGGACTATGGGACAACGGCGCTGCCTGCGGTCGACGATATAGATTACGATGTTTGAGTGGACGAAACCGTCCGTGCAAGACCGACATCATCGAAGTTCAGGTGGTGAACTTCTGTCCAAAGTCGCCATGCCCCTCTTCCTTTCTCATGTCCAAAGAAGCCTTTGCTGCCATCTCCCACCTCCCCAATGCTAGACTAAACGTCGAATACATTGAGTACGTAATCTTTTCTCCTTTTCCAAGTTAA ATGGCACTTCAACACAAGGCAACAACAACGGCTCTCCTCATCTTCTTCTTATTCTTTAAACACATTTTCATAGCTCTTGCAGACATCGGCACTGCCACAGCCTATGGTCCTCCATATCTTCCCACCCTGTGTAATGGGAACGACGTCTACCAATTCCCGCCTGGCAACCTCTTCGTGGCAGTCAACGAAGGACTATGGGACAACGGCGCTGCCTGCGGTCGACGATATAGATTACGATGTTTGAGTGGACGAAACCGTCCGTGCAAGACCGACATCATCGAAGTTCAGGTGGTGAACTTCTGTCCAAAGTCGCCATGCCCCTCTTCCTTTCTCATGTCCAAAGAAGCCTTTGCTGCCATCTCCCACCTCCCCAATGCTAGACTAAACGTCGAATACATTGAGTACGTAATCTTTTCTCCTTTTCCAAGTTAA MALQHKATTTALLIFFLFFKHIFIALADIGTATAYGPPYLPTLCNGNDVYQFPPGNLFVAVNEGLWDNGAACGRRYRLRCLSGRNRPCKTDIIEVQVVNFCPKSPCPSSFLMSKEAFAAISHLPNARLNVEYIEYVIFSPFPS Homology
BLAST of Lcy01g015050 vs. ExPASy Swiss-Prot
Match: Q9ZP41 (EG45-like domain containing protein OS=Citrus jambhiri OX=64884 GN=CjBAp12 PE=1 SV=1) HSP 1 Score: 79.7 bits (195), Expect = 2.9e-14 Identity = 39/114 (34.21%), Postives = 67/114 (58.77%), Query Frame = 0
BLAST of Lcy01g015050 vs. ExPASy Swiss-Prot
Match: Q9ZV52 (EG45-like domain containing protein 2 OS=Arabidopsis thaliana OX=3702 GN=EGC2 PE=2 SV=2) HSP 1 Score: 75.5 bits (184), Expect = 5.5e-13 Identity = 42/125 (33.60%), Postives = 62/125 (49.60%), Query Frame = 0
BLAST of Lcy01g015050 vs. ExPASy Swiss-Prot
Match: Q9M0C2 (Putative EG45-like domain containing protein 1 OS=Arabidopsis thaliana OX=3702 GN=EGC1 PE=3 SV=1) HSP 1 Score: 62.4 bits (150), Expect = 4.8e-09 Identity = 38/126 (30.16%), Postives = 64/126 (50.79%), Query Frame = 0
BLAST of Lcy01g015050 vs. ExPASy TrEMBL
Match: A0A6J1GHJ6 (EG45-like domain containing protein OS=Cucurbita moschata OX=3662 GN=LOC111454241 PE=4 SV=1) HSP 1 Score: 238.4 bits (607), Expect = 1.8e-59 Identity = 114/129 (88.37%), Postives = 117/129 (90.70%), Query Frame = 0
BLAST of Lcy01g015050 vs. ExPASy TrEMBL
Match: A0A6J1BR12 (EG45-like domain containing protein OS=Momordica charantia OX=3673 GN=LOC111004811 PE=4 SV=1) HSP 1 Score: 238.0 bits (606), Expect = 2.4e-59 Identity = 114/134 (85.07%), Postives = 117/134 (87.31%), Query Frame = 0
BLAST of Lcy01g015050 vs. ExPASy TrEMBL
Match: A0A6J1HDP3 (EG45-like domain containing protein OS=Cucurbita moschata OX=3662 GN=LOC111462575 PE=4 SV=1) HSP 1 Score: 236.1 bits (601), Expect = 9.0e-59 Identity = 111/134 (82.84%), Postives = 118/134 (88.06%), Query Frame = 0
BLAST of Lcy01g015050 vs. ExPASy TrEMBL
Match: A0A6J1K9Z5 (EG45-like domain containing protein OS=Cucurbita maxima OX=3661 GN=LOC111492001 PE=4 SV=1) HSP 1 Score: 234.2 bits (596), Expect = 3.4e-58 Identity = 110/134 (82.09%), Postives = 118/134 (88.06%), Query Frame = 0
BLAST of Lcy01g015050 vs. ExPASy TrEMBL
Match: A0A5A7V9U1 (EG45-like domain containing protein OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold82G002510 PE=4 SV=1) HSP 1 Score: 232.6 bits (592), Expect = 1.0e-57 Identity = 107/123 (86.99%), Postives = 113/123 (91.87%), Query Frame = 0
BLAST of Lcy01g015050 vs. NCBI nr
Match: KAG6585463.1 (EG45-like domain containing protein, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 248.1 bits (632), Expect = 4.7e-62 Identity = 122/139 (87.77%), Postives = 125/139 (89.93%), Query Frame = 0
BLAST of Lcy01g015050 vs. NCBI nr
Match: KAG6598574.1 (EG45-like domain containing protein, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 240.0 bits (611), Expect = 1.3e-59 Identity = 114/139 (82.01%), Postives = 121/139 (87.05%), Query Frame = 0
BLAST of Lcy01g015050 vs. NCBI nr
Match: XP_022951412.1 (EG45-like domain containing protein [Cucurbita moschata]) HSP 1 Score: 238.4 bits (607), Expect = 3.8e-59 Identity = 114/129 (88.37%), Postives = 117/129 (90.70%), Query Frame = 0
BLAST of Lcy01g015050 vs. NCBI nr
Match: XP_022131704.1 (EG45-like domain containing protein [Momordica charantia]) HSP 1 Score: 238.0 bits (606), Expect = 4.9e-59 Identity = 114/134 (85.07%), Postives = 117/134 (87.31%), Query Frame = 0
BLAST of Lcy01g015050 vs. NCBI nr
Match: XP_023537855.1 (EG45-like domain containing protein [Cucurbita pepo subsp. pepo]) HSP 1 Score: 237.3 bits (604), Expect = 8.4e-59 Identity = 112/128 (87.50%), Postives = 116/128 (90.62%), Query Frame = 0
BLAST of Lcy01g015050 vs. TAIR 10
Match: AT2G18660.1 (plant natriuretic peptide A ) HSP 1 Score: 75.5 bits (184), Expect = 3.9e-14 Identity = 42/125 (33.60%), Postives = 62/125 (49.60%), Query Frame = 0
BLAST of Lcy01g015050 vs. TAIR 10
Match: AT4G30380.1 (Barwin-related endoglucanase ) HSP 1 Score: 62.4 bits (150), Expect = 3.4e-10 Identity = 38/126 (30.16%), Postives = 64/126 (50.79%), Query Frame = 0
BLAST of Lcy01g015050 vs. TAIR 10
Match: AT1G20190.1 (expansin 11 ) HSP 1 Score: 42.0 bits (97), Expect = 4.8e-04 Identity = 25/79 (31.65%), Postives = 39/79 (49.37%), Query Frame = 0
BLAST of Lcy01g015050 vs. TAIR 10
Match: AT2G40610.1 (expansin A8 ) HSP 1 Score: 41.6 bits (96), Expect = 6.3e-04 Identity = 25/80 (31.25%), Postives = 36/80 (45.00%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Sponge gourd (P93075) v1
Date Performed: 2021-12-06
Relationships
The following mRNA feature(s) are a part of this gene:
|