Sequences
The following sequences are available for this feature:
Legend: exon CDS polypeptide
Hold the cursor over a type above to highlight its positions in the sequence below.
ATGTCGACACGCAGAAATTCCGAGGGAGAAAACCAGAGTCATGAAAGCGACAGAACGAAAGAAAGTGATCGCATTTTCGAGCT TTTTCGAATGAGATATCCGATCGTCGGGGGCGATCGGAGATGTTCTTCGGCGGTGGTGTTGGAGACGGATTTGGTAGCAGAGGAGATTGGTGGTGAGACCGATGGTTCCGATGGTGATTTGGACGGTTGGCCGAGTGATTCAGTAGAGACAGTGCTGTCTTGCTGCAGACTACAGTTGTACTAG
ATGTCGACACGCAGAAATTCCGAGGGAGAAAACCAGAGTCATGAAAGCGACAGAACGAAAGAAAGTGATCGCATTTTCGAGCTTTTTCGAATGAGATATCCGATCGTCGGGGGCGATCGGAGATGTTCTTCGGCGGTGGTGTTGGAGACGGATTTGGTAGCAGAGGAGATTGGTGGTGAGACCGATGGTTCCGATGGTGATTTGGACGGTTGGCCGAGTGATTCAGTAGAGACAGTGCTGTCTTGCTGCAGACTACAGTTGTACTAG
ATGTCGACACGCAGAAATTCCGAGGGAGAAAACCAGAGTCATGAAAGCGACAGAACGAAAGAAAGTGATCGCATTTTCGAGCTTTTTCGAATGAGATATCCGATCGTCGGGGGCGATCGGAGATGTTCTTCGGCGGTGGTGTTGGAGACGGATTTGGTAGCAGAGGAGATTGGTGGTGAGACCGATGGTTCCGATGGTGATTTGGACGGTTGGCCGAGTGATTCAGTAGAGACAGTGCTGTCTTGCTGCAGACTACAGTTGTACTAG
MSTRRNSEGENQSHESDRTKESDRIFELFRMRYPIVGGDRRCSSAVVLETDLVAEEIGGETDGSDGDLDGWPSDSVETVLSCCRLQLY
Homology
BLAST of Lag0002450 vs. NCBI nr
Match:
KAG6575880.1 (39S ribosomal protein L46, mitochondrial, partial [Cucurbita argyrosperma subsp. sororia])
HSP 1 Score: 93.2 bits (230), Expect = 1.2e-15
Identity = 44/54 (81.48%), Postives = 45/54 (83.33%), Query Frame = 0
BLAST of Lag0002450 vs. NCBI nr
Match:
KAA0057555.1 (autophagy-related protein 18g isoform X1 [Cucumis melo var. makuwa])
HSP 1 Score: 79.3 bits (194), Expect = 1.8e-11
Identity = 36/49 (73.47%), Postives = 41/49 (83.67%), Query Frame = 0
BLAST of Lag0002450 vs. NCBI nr
Match:
TYK18276.1 (autophagy-related protein 18g isoform X2 [Cucumis melo var. makuwa])
HSP 1 Score: 79.3 bits (194), Expect = 1.8e-11
Identity = 36/49 (73.47%), Postives = 41/49 (83.67%), Query Frame = 0
The following BLAST results are available for this feature:
Match Name E-value Identity Description
KAG6575880.1 1.2e-15 81.48 39S ribosomal protein L46, mitochondrial, partial [Cucurbita argyrosperma subsp.... [more] KAA0057555.1 1.8e-11 73.47 autophagy-related protein 18g isoform X1 [Cucumis melo var. makuwa] [more] TYK18276.1 1.8e-11 73.47 autophagy-related protein 18g isoform X2 [Cucumis melo var. makuwa] [more]
Match Name E-value Identity Description
InterPro
Analysis Name: InterPro Annotations of Sponge gourd (AG-4) v1
Date Performed: 2022-08-01
A T G T C G A C A C G C A G A A A T T C C G A G G G A G A A A A C C A G A G T C A T G A A A G C G A C A G A A C G A A A G A A A G T G A T C G C A T T T T C G A G C T T T T T C G A A T G A G A T A T C C G A T C G T C G G G G G C G A T C G G A G A T G T T C T T C G G C G G T G G T G T T G G A G A C G G A T T T G G T A G C A G A G G A G A T T G G T G G T G A G A C C G A T G G T T C C G A T G G T G A T T T G G A C G G T T G G C C G A G T G A T T C A G T A G A G A C A G T G C T G T C T T G C T G C A G A C T A C A G T T G T A C T A G 20 40 60 80 100 120 140 160 180 200 220 240 260 Score = Sequence mobidb-lite
IPR Term IPR Description Source Source Term Source Description Alignment
None No IPR available MOBIDB_LITE mobidb-lite disorder_prediction coord: 1..21
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
Category
Term Accession
Term Name
biological_process
GO:0006914 autophagy
