IVF0026133 (gene) Melon (IVF77) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGAACAAAAAGTTTGAGATATATGATAAGGAGGTAGAAGCTGCTAAGAGAGATCTGGAAGCAGAGCTCAACAAGAGAAGGTGAAAGACCGAGCAAAGTTTGCTGCTCTGCTAAGGAAGCCTAAAAAAACAAGTCGAAGGTAAAGGTTGATGAGGACGATCCCTTACCCGAGGCCCCCAGAAAATGGAGAGATTACAGTATAGAGTTCCACTTCCCTGAACCCACAGAGCTCACCCCACCATTATTACAATTGATTGAATTCAATTTCAGTTATCCAAATAGGAAAGATTTTAGACTTGCTGATGTCGATGTAGGCATTGACATGGGAACACGTGTTGCTATTGTCGGACCGAATGGAGCAGGAAAATCAACTCTTTTGAATCTGCTAGCAGGTGATCTCGTTCCAACTTCCAACAGAAGGGGAAGTACGCAGGAGTCAAAAGTTGAGAATTAGGAGGTATTCGCAACATTTTGTAGACCTTCTATCAATGGAGGAAACACCAGTTCAGTATCTTCTTCGTCTTCATCCCGATCAAGACGGTCTAAGCAAACAGGAAGCTGTTCGTGCTAA ATGAACAAAAAGTTTGAGATATATGATAAGGAGGTAGAAGCTGCTAAGAGAGATCTGGAAGCAGAGCTCAACAAGAGAAGTTATCCAAATAGGAAAGATTTTAGACTTGCTGATGTCGATGTAGGCATTGACATGGGAACACGTGTTGCTATTGTCGGACCGAATGGAGCAGGAAAATCAACTCTTTTGAATCTGCTAGCAGGTGATCTCGTTCCAACTTCCAACAGAAGGGGAAGTACGCAGGAACCTTCTATCAATGGAGGAAACACCAGTTCAGTATCTTCTTCGTCTTCATCCCGATCAAGACGGTCTAAGCAAACAGGAAGCTGTTCGTGCTAA ATGAACAAAAAGTTTGAGATATATGATAAGGAGGTAGAAGCTGCTAAGAGAGATCTGGAAGCAGAGCTCAACAAGAGAAGTTATCCAAATAGGAAAGATTTTAGACTTGCTGATGTCGATGTAGGCATTGACATGGGAACACGTGTTGCTATTGTCGGACCGAATGGAGCAGGAAAATCAACTCTTTTGAATCTGCTAGCAGGTGATCTCGTTCCAACTTCCAACAGAAGGGGAAGTACGCAGGAACCTTCTATCAATGGAGGAAACACCAGTTCAGTATCTTCTTCGTCTTCATCCCGATCAAGACGGTCTAAGCAAACAGGAAGCTGTTCGTGCTAA MNKKFEIYDKEVEAAKRDLEAELNKRSYPNRKDFRLADVDVGIDMGTRVAIVGPNGAGKSTLLNLLAGDLVPTSNRRGSTQEPSINGGNTSSVSSSSSSRSRRSKQTGSCSC Homology
BLAST of IVF0026133 vs. ExPASy Swiss-Prot
Match: Q9M1H3 (ABC transporter F family member 4 OS=Arabidopsis thaliana OX=3702 GN=ABCF4 PE=2 SV=1) HSP 1 Score: 91.3 bits (225), Expect = 7.6e-18 Identity = 45/56 (80.36%), Postives = 49/56 (87.50%), Query Frame = 0
BLAST of IVF0026133 vs. ExPASy Swiss-Prot
Match: O14134 (mRNA export factor elf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=elf1 PE=1 SV=1) HSP 1 Score: 57.4 bits (137), Expect = 1.2e-07 Identity = 25/50 (50.00%), Postives = 37/50 (74.00%), Query Frame = 0
BLAST of IVF0026133 vs. ExPASy Swiss-Prot
Match: Q2KJA2 (ATP-binding cassette sub-family F member 2 OS=Bos taurus OX=9913 GN=ABCF2 PE=2 SV=1) HSP 1 Score: 56.2 bits (134), Expect = 2.7e-07 Identity = 25/36 (69.44%), Postives = 32/36 (88.89%), Query Frame = 0
BLAST of IVF0026133 vs. ExPASy Swiss-Prot
Match: Q9UG63 (ATP-binding cassette sub-family F member 2 OS=Homo sapiens OX=9606 GN=ABCF2 PE=1 SV=2) HSP 1 Score: 56.2 bits (134), Expect = 2.7e-07 Identity = 25/36 (69.44%), Postives = 32/36 (88.89%), Query Frame = 0
BLAST of IVF0026133 vs. ExPASy Swiss-Prot
Match: Q99LE6 (ATP-binding cassette sub-family F member 2 OS=Mus musculus OX=10090 GN=Abcf2 PE=1 SV=1) HSP 1 Score: 56.2 bits (134), Expect = 2.7e-07 Identity = 25/36 (69.44%), Postives = 32/36 (88.89%), Query Frame = 0
BLAST of IVF0026133 vs. ExPASy TrEMBL
Match: A0A5A7TCU9 (Stress-associated endoplasmic reticulum protein 2-like OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold122G001960 PE=3 SV=1) HSP 1 Score: 132.9 bits (333), Expect = 8.4e-28 Identity = 67/67 (100.00%), Postives = 67/67 (100.00%), Query Frame = 0
BLAST of IVF0026133 vs. ExPASy TrEMBL
Match: A0A5D3DLW2 (ABC transporter F family member 4 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold266G001290 PE=3 SV=1) HSP 1 Score: 132.9 bits (333), Expect = 8.4e-28 Identity = 67/67 (100.00%), Postives = 67/67 (100.00%), Query Frame = 0
BLAST of IVF0026133 vs. ExPASy TrEMBL
Match: A0A6A2ZME9 (ABC transporter F family member 4 OS=Hibiscus syriacus OX=106335 GN=F3Y22_tig00110819pilonHSYRG00013 PE=4 SV=1) HSP 1 Score: 109.0 bits (271), Expect = 1.3e-20 Identity = 59/94 (62.77%), Postives = 72/94 (76.60%), Query Frame = 0
BLAST of IVF0026133 vs. ExPASy TrEMBL
Match: A0A7J0F6P0 (General control non-repressible 4 OS=Actinidia rufa OX=165716 GN=Acr_09g0008280 PE=4 SV=1) HSP 1 Score: 105.1 bits (261), Expect = 1.9e-19 Identity = 60/100 (60.00%), Postives = 68/100 (68.00%), Query Frame = 0
BLAST of IVF0026133 vs. ExPASy TrEMBL
Match: A0A5D2P1Y8 (ABC transporter domain-containing protein OS=Gossypium tomentosum OX=34277 GN=ES332_A09G133100v1 PE=4 SV=1) HSP 1 Score: 100.5 bits (249), Expect = 4.6e-18 Identity = 59/89 (66.29%), Postives = 68/89 (76.40%), Query Frame = 0
BLAST of IVF0026133 vs. NCBI nr
Match: TYK24584.1 (ABC transporter F family member 4 [Cucumis melo var. makuwa]) HSP 1 Score: 131 bits (329), Expect = 5.99e-36 Identity = 67/67 (100.00%), Postives = 67/67 (100.00%), Query Frame = 0
BLAST of IVF0026133 vs. NCBI nr
Match: KAA0039916.1 (stress-associated endoplasmic reticulum protein 2-like [Cucumis melo var. makuwa]) HSP 1 Score: 131 bits (329), Expect = 3.40e-35 Identity = 67/67 (100.00%), Postives = 67/67 (100.00%), Query Frame = 0
BLAST of IVF0026133 vs. NCBI nr
Match: KAE8692933.1 (ABC transporter F family member 4 [Hibiscus syriacus]) HSP 1 Score: 108 bits (269), Expect = 1.14e-24 Identity = 58/85 (68.24%), Postives = 69/85 (81.18%), Query Frame = 0
BLAST of IVF0026133 vs. NCBI nr
Match: GFY94382.1 (general control non-repressible 4 [Actinidia rufa]) HSP 1 Score: 103 bits (256), Expect = 7.71e-23 Identity = 60/100 (60.00%), Postives = 68/100 (68.00%), Query Frame = 0
BLAST of IVF0026133 vs. NCBI nr
Match: KAG4183452.1 (hypothetical protein ERO13_A09G110551v2 [Gossypium hirsutum]) HSP 1 Score: 98.2 bits (243), Expect = 4.05e-21 Identity = 59/88 (67.05%), Postives = 67/88 (76.14%), Query Frame = 0
BLAST of IVF0026133 vs. TAIR 10
Match: AT3G54540.1 (general control non-repressible 4 ) HSP 1 Score: 91.3 bits (225), Expect = 5.4e-19 Identity = 45/56 (80.36%), Postives = 49/56 (87.50%), Query Frame = 0
BLAST of IVF0026133 vs. TAIR 10
Match: AT5G60790.1 (ABC transporter family protein ) HSP 1 Score: 54.3 bits (129), Expect = 7.3e-08 Identity = 23/36 (63.89%), Postives = 31/36 (86.11%), Query Frame = 0
BLAST of IVF0026133 vs. TAIR 10
Match: AT1G64550.1 (general control non-repressible 3 ) HSP 1 Score: 50.4 bits (119), Expect = 1.1e-06 Identity = 21/37 (56.76%), Postives = 32/37 (86.49%), Query Frame = 0
BLAST of IVF0026133 vs. TAIR 10
Match: AT4G25450.1 (non-intrinsic ABC protein 8 ) HSP 1 Score: 41.6 bits (96), Expect = 4.9e-04 Identity = 22/51 (43.14%), Postives = 33/51 (64.71%), Query Frame = 0
BLAST of IVF0026133 vs. TAIR 10
Match: AT4G25450.2 (non-intrinsic ABC protein 8 ) HSP 1 Score: 41.6 bits (96), Expect = 4.9e-04 Identity = 22/51 (43.14%), Postives = 33/51 (64.71%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (IVF77) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|