
IVF0025346 (gene) Melon (IVF77) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTTTGATGGGTGGTTTTGCTAGAATAGGGAATAATGAGGCCACTATTTTAGTCAATGATGGGGAGAAGGTTGGTGACATTGATCCACAAGAAGCTCAGCAAACTCTTGAAATAGCGGTAGCCAACTTGAGGAAAGGTCAGGGCAAGAGACAAAGAATCGAGGCAAATTGA ATGGCTTTGATGGGTGGTTTTGCTAGAATAGGGAATAATGAGGCCACTATTTTAGTCAATGATGGGGAGAAGGTTGGTGACATTGATCCACAAGAAGCTCAGCAAACTCTTGAAATAGCGGTAGCCAACTTGAGGAAAGGTCAGGGCAAGAGACAAAGAATCGAGGCAAATTGA ATGGCTTTGATGGGTGGTTTTGCTAGAATAGGGAATAATGAGGCCACTATTTTAGTCAATGATGGGGAGAAGGTTGGTGACATTGATCCACAAGAAGCTCAGCAAACTCTTGAAATAGCGGTAGCCAACTTGAGGAAAGGTCAGGGCAAGAGACAAAGAATCGAGGCAAATTGA MALMGGFARIGNNEATILVNDGEKVGDIDPQEAQQTLEIAVANLRKGQGKRQRIEAN Homology
BLAST of IVF0025346 vs. ExPASy Swiss-Prot
Match: Q4VZG9 (ATP synthase epsilon chain, chloroplastic OS=Cucumis sativus OX=3659 GN=atpE PE=3 SV=1) HSP 1 Score: 97.8 bits (242), Expect = 4.1e-20 Identity = 50/57 (87.72%), Postives = 50/57 (87.72%), Query Frame = 0
BLAST of IVF0025346 vs. ExPASy Swiss-Prot
Match: P09468 (ATP synthase epsilon chain, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=atpE PE=1 SV=2) HSP 1 Score: 95.1 bits (235), Expect = 2.7e-19 Identity = 49/57 (85.96%), Postives = 50/57 (87.72%), Query Frame = 0
BLAST of IVF0025346 vs. ExPASy Swiss-Prot
Match: Q06RC3 (ATP synthase epsilon chain, chloroplastic OS=Jasminum nudiflorum OX=126431 GN=atpE PE=3 SV=1) HSP 1 Score: 94.4 bits (233), Expect = 4.6e-19 Identity = 47/57 (82.46%), Postives = 51/57 (89.47%), Query Frame = 0
BLAST of IVF0025346 vs. ExPASy Swiss-Prot
Match: Q332X2 (ATP synthase epsilon chain, chloroplastic OS=Lactuca sativa OX=4236 GN=atpE PE=3 SV=1) HSP 1 Score: 94.4 bits (233), Expect = 4.6e-19 Identity = 48/57 (84.21%), Postives = 50/57 (87.72%), Query Frame = 0
BLAST of IVF0025346 vs. ExPASy Swiss-Prot
Match: Q14FF1 (ATP synthase epsilon chain, chloroplastic OS=Populus alba OX=43335 GN=atpE PE=3 SV=1) HSP 1 Score: 94.4 bits (233), Expect = 4.6e-19 Identity = 48/57 (84.21%), Postives = 50/57 (87.72%), Query Frame = 0
BLAST of IVF0025346 vs. ExPASy TrEMBL
Match: A0A5D3BC62 (ATP synthase CF1 epsilon subunit (Chloroplast) OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold194G002480 PE=4 SV=1) HSP 1 Score: 112.5 bits (280), Expect = 6.0e-22 Identity = 57/57 (100.00%), Postives = 57/57 (100.00%), Query Frame = 0
BLAST of IVF0025346 vs. ExPASy TrEMBL
Match: A0A5A7VIY7 (ATP synthase epsilon subunit (Chloroplast) OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold352G00270 PE=4 SV=1) HSP 1 Score: 102.1 bits (253), Expect = 8.1e-19 Identity = 51/51 (100.00%), Postives = 51/51 (100.00%), Query Frame = 0
BLAST of IVF0025346 vs. ExPASy TrEMBL
Match: A0A6H0ENP8 (ATP synthase epsilon chain, chloroplastic OS=Thladiantha dubia OX=210344 GN=atpE PE=3 SV=1) HSP 1 Score: 99.8 bits (247), Expect = 4.0e-18 Identity = 51/57 (89.47%), Postives = 51/57 (89.47%), Query Frame = 0
BLAST of IVF0025346 vs. ExPASy TrEMBL
Match: E0XEI1 (ATP synthase epsilon chain, chloroplastic (Fragment) OS=Cuttsia viburnea OX=54176 GN=atpE PE=3 SV=1) HSP 1 Score: 98.6 bits (244), Expect = 9.0e-18 Identity = 49/57 (85.96%), Postives = 52/57 (91.23%), Query Frame = 0
BLAST of IVF0025346 vs. ExPASy TrEMBL
Match: E0XEH0 (ATP synthase epsilon chain, chloroplastic (Fragment) OS=Abrophyllum ornans OX=49579 GN=atpE PE=3 SV=1) HSP 1 Score: 98.6 bits (244), Expect = 9.0e-18 Identity = 49/57 (85.96%), Postives = 52/57 (91.23%), Query Frame = 0
BLAST of IVF0025346 vs. NCBI nr
Match: TYJ97422.1 (ATP synthase CF1 epsilon subunit [Cucumis melo var. makuwa]) HSP 1 Score: 112 bits (279), Expect = 6.08e-31 Identity = 57/57 (100.00%), Postives = 57/57 (100.00%), Query Frame = 0
BLAST of IVF0025346 vs. NCBI nr
Match: KAA0067718.1 (ATP synthase epsilon subunit [Cucumis melo var. makuwa]) HSP 1 Score: 101 bits (251), Expect = 9.90e-27 Identity = 51/51 (100.00%), Postives = 51/51 (100.00%), Query Frame = 0
BLAST of IVF0025346 vs. NCBI nr
Match: YP_009751491.1 (CF1 subunit epsilon [Thladiantha dubia] >QIT03972.1 CF1 subunit epsilon [Thladiantha dubia]) HSP 1 Score: 99.4 bits (246), Expect = 5.89e-25 Identity = 51/57 (89.47%), Postives = 51/57 (89.47%), Query Frame = 0
BLAST of IVF0025346 vs. NCBI nr
Match: ADM63624.1 (ATP synthase CF1 epsilon subunit, partial [Abrophyllum ornans]) HSP 1 Score: 98.2 bits (243), Expect = 9.66e-25 Identity = 49/57 (85.96%), Postives = 52/57 (91.23%), Query Frame = 0
BLAST of IVF0025346 vs. NCBI nr
Match: ADM63635.1 (ATP synthase CF1 epsilon subunit, partial [Cuttsia viburnea]) HSP 1 Score: 98.2 bits (243), Expect = 1.28e-24 Identity = 49/57 (85.96%), Postives = 52/57 (91.23%), Query Frame = 0
BLAST of IVF0025346 vs. TAIR 10
Match: ATCG00470.1 (ATP synthase epsilon chain ) HSP 1 Score: 95.1 bits (235), Expect = 1.9e-20 Identity = 49/57 (85.96%), Postives = 50/57 (87.72%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (IVF77) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|