
IVF0025339 (gene) Melon (IVF77) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGAATAGAACATTGATTGAAAGGGTTAGATGTATGTTATCAGAAGCCAAACTTCCTGAAGATTTTTGGGTTGAATCCCTAGCCACAGCAACATACACCACTAATAGAAGTCCTAGTATTTCTATCAACATGAAGACCCCTGAAGAAATGTGGAAGGGATCAGCTCCTGACTTATCAAACTTAAAGACCTTCAGATGCACAATCTATATACATACTAAGCAAAGTAAGGTGGAGCCTAGAGCTATAAAATGTATGTTCATAGGGTATCCTGAAGGAGTGAAAGGGTATAAGTGCTGGAACTTTATTTCAAACAGAAGCCTGATTAGTAGAGATGTGACTTTCAAAGAAGATGAGTTCTACATGAACTCTGAAACAAGCTAG ATGAATAGAACATTGATTGAAAGGGTTAGATGTATGTTATCAGAAGCCAAACTTCCTGAAGATTTTTGGGTTGAATCCCTAGCCACAGCAACATACACCACTAATAGAAGTCCTAGTATTTCTATCAACATGAAGACCCCTGAAGAAATGTGGAAGGGATCAGCTCCTGACTTATCAAACTTAAAGACCTTCAGATGCACAATCTATATACATACTAAGCAAAGTAAGGTGGAGCCTAGAGCTATAAAATGTATGTTCATAGGGTATCCTGAAGGAGTGAAAGGGTATAAGTGCTGGAACTTTATTTCAAACAGAAGCCTGATTAGTAGAGATGTGACTTTCAAAGAAGATGAGTTCTACATGAACTCTGAAACAAGCTAG ATGAATAGAACATTGATTGAAAGGGTTAGATGTATGTTATCAGAAGCCAAACTTCCTGAAGATTTTTGGGTTGAATCCCTAGCCACAGCAACATACACCACTAATAGAAGTCCTAGTATTTCTATCAACATGAAGACCCCTGAAGAAATGTGGAAGGGATCAGCTCCTGACTTATCAAACTTAAAGACCTTCAGATGCACAATCTATATACATACTAAGCAAAGTAAGGTGGAGCCTAGAGCTATAAAATGTATGTTCATAGGGTATCCTGAAGGAGTGAAAGGGTATAAGTGCTGGAACTTTATTTCAAACAGAAGCCTGATTAGTAGAGATGTGACTTTCAAAGAAGATGAGTTCTACATGAACTCTGAAACAAGCTAG MNRTLIERVRCMLSEAKLPEDFWVESLATATYTTNRSPSISINMKTPEEMWKGSAPDLSNLKTFRCTIYIHTKQSKVEPRAIKCMFIGYPEGVKGYKCWNFISNRSLISRDVTFKEDEFYMNSETS Homology
BLAST of IVF0025339 vs. ExPASy Swiss-Prot
Match: P10978 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum OX=4097 PE=2 SV=1) HSP 1 Score: 111.7 bits (278), Expect = 6.1e-24 Identity = 50/121 (41.32%), Postives = 77/121 (63.64%), Query Frame = 0
BLAST of IVF0025339 vs. ExPASy Swiss-Prot
Match: P04146 (Copia protein OS=Drosophila melanogaster OX=7227 GN=GIP PE=1 SV=3) HSP 1 Score: 98.2 bits (243), Expect = 7.0e-20 Identity = 48/120 (40.00%), Postives = 74/120 (61.67%), Query Frame = 0
BLAST of IVF0025339 vs. ExPASy Swiss-Prot
Match: P92512 (Uncharacterized mitochondrial protein AtMg00710 OS=Arabidopsis thaliana OX=3702 GN=AtMg00710 PE=4 SV=1) HSP 1 Score: 80.5 bits (197), Expect = 1.5e-14 Identity = 38/83 (45.78%), Postives = 52/83 (62.65%), Query Frame = 0
BLAST of IVF0025339 vs. ExPASy Swiss-Prot
Match: Q94HW2 (Retrovirus-related Pol polyprotein from transposon RE1 OS=Arabidopsis thaliana OX=3702 GN=RE1 PE=2 SV=1) HSP 1 Score: 72.4 bits (176), Expect = 4.1e-12 Identity = 36/121 (29.75%), Postives = 66/121 (54.55%), Query Frame = 0
BLAST of IVF0025339 vs. ExPASy TrEMBL
Match: A0A5A7V1Q9 (Retrotransposon protein, putative, Ty1-copia subclass OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold22G002350 PE=4 SV=1) HSP 1 Score: 264.6 bits (675), Expect = 2.1e-67 Identity = 126/126 (100.00%), Postives = 126/126 (100.00%), Query Frame = 0
BLAST of IVF0025339 vs. ExPASy TrEMBL
Match: A0A5D3CIE0 (Retrotransposon protein, putative, Ty1-copia subclass OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold69664G00030 PE=4 SV=1) HSP 1 Score: 262.7 bits (670), Expect = 7.9e-67 Identity = 125/126 (99.21%), Postives = 125/126 (99.21%), Query Frame = 0
BLAST of IVF0025339 vs. ExPASy TrEMBL
Match: A0A5D3BXB7 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold145G00480 PE=4 SV=1) HSP 1 Score: 238.8 bits (608), Expect = 1.2e-59 Identity = 110/126 (87.30%), Postives = 117/126 (92.86%), Query Frame = 0
BLAST of IVF0025339 vs. ExPASy TrEMBL
Match: A0A5A7TF17 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold768G00060 PE=4 SV=1) HSP 1 Score: 233.4 bits (594), Expect = 5.1e-58 Identity = 109/126 (86.51%), Postives = 117/126 (92.86%), Query Frame = 0
BLAST of IVF0025339 vs. ExPASy TrEMBL
Match: A0A5D3CPM8 (Pentatricopeptide repeat-containing protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold302G00430 PE=4 SV=1) HSP 1 Score: 193.7 bits (491), Expect = 4.5e-46 Identity = 86/123 (69.92%), Postives = 104/123 (84.55%), Query Frame = 0
BLAST of IVF0025339 vs. NCBI nr
Match: KAA0060416.1 (retrotransposon protein, putative, Ty1-copia subclass [Cucumis melo var. makuwa]) HSP 1 Score: 262 bits (670), Expect = 1.03e-87 Identity = 126/126 (100.00%), Postives = 126/126 (100.00%), Query Frame = 0
BLAST of IVF0025339 vs. NCBI nr
Match: TYK11325.1 (retrotransposon protein, putative, Ty1-copia subclass [Cucumis melo var. makuwa]) HSP 1 Score: 260 bits (665), Expect = 5.94e-87 Identity = 125/126 (99.21%), Postives = 125/126 (99.21%), Query Frame = 0
BLAST of IVF0025339 vs. NCBI nr
Match: TYK02789.1 (retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cucumis melo var. makuwa]) HSP 1 Score: 236 bits (603), Expect = 3.70e-75 Identity = 110/126 (87.30%), Postives = 117/126 (92.86%), Query Frame = 0
BLAST of IVF0025339 vs. NCBI nr
Match: KAA0040137.1 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cucumis melo var. makuwa]) HSP 1 Score: 231 bits (589), Expect = 1.34e-73 Identity = 109/126 (86.51%), Postives = 117/126 (92.86%), Query Frame = 0
BLAST of IVF0025339 vs. NCBI nr
Match: KAA0043186.1 (pentatricopeptide repeat-containing protein [Cucumis melo var. makuwa]) HSP 1 Score: 191 bits (486), Expect = 1.39e-53 Identity = 86/123 (69.92%), Postives = 104/123 (84.55%), Query Frame = 0
BLAST of IVF0025339 vs. TAIR 10
Match: ATMG00710.1 (Polynucleotidyl transferase, ribonuclease H-like superfamily protein ) HSP 1 Score: 80.5 bits (197), Expect = 1.1e-15 Identity = 38/83 (45.78%), Postives = 52/83 (62.65%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (IVF77) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|