![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
IVF0025321 (gene) Melon (IVF77) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGATATTAAACACATATGATGAACTTGAAAAGGATGTATTAGTGGCTAGAACTCTCCCTTTCTCCAATCCTCATCATTATACAGTTGGTCCACTTCACATGATGGTCAAACAAATTGAGGATGAAAAAAAAGAAGAGCAGTAGGTTCAAATCTTTGGGTGGAGGAATCTGAATGCATTGAATGGTTGAATTCAAAGGAACCCAATTATGTGGTTTATGTTAACTTAGGTAGCATCACAGTGATGACAAAACAAGTAGTATTGAAGTTTCGGGCACAAAAACCCCACATGGAAGAACATTAA ATGATATTAAACACATATGATGAACTTGAAAAGGATGTATTAGTGGCTAGAACTCTCCCTTTCTCCAATCCTCATCATTATACAGTTGGTCCACTTCACATGATGGAATCTGAATGCATTGAATGGTTGAATTCAAAGGAACCCAATTATGTGGTTTATGTTAACTTAGGTAGCATCACAGTGATGACAAAACAAGTAGTATTGAAGTTTCGGGCACAAAAACCCCACATGGAAGAACATTAA ATGATATTAAACACATATGATGAACTTGAAAAGGATGTATTAGTGGCTAGAACTCTCCCTTTCTCCAATCCTCATCATTATACAGTTGGTCCACTTCACATGATGGAATCTGAATGCATTGAATGGTTGAATTCAAAGGAACCCAATTATGTGGTTTATGTTAACTTAGGTAGCATCACAGTGATGACAAAACAAGTAGTATTGAAGTTTCGGGCACAAAAACCCCACATGGAAGAACATTAA MILNTYDELEKDVLVARTLPFSNPHHYTVGPLHMMESECIEWLNSKEPNYVVYVNLGSITVMTKQVVLKFRAQKPHMEEH Homology
BLAST of IVF0025321 vs. ExPASy Swiss-Prot
Match: Q6VAB3 (UDP-glycosyltransferase 85A8 OS=Stevia rebaudiana OX=55670 GN=UGT85A8 PE=2 SV=1) HSP 1 Score: 74.3 bits (181), Expect = 6.9e-13 Identity = 40/90 (44.44%), Postives = 53/90 (58.89%), Query Frame = 0
BLAST of IVF0025321 vs. ExPASy Swiss-Prot
Match: Q9LMF0 (UDP-glycosyltransferase 85A5 OS=Arabidopsis thaliana OX=3702 GN=UGT85A5 PE=2 SV=1) HSP 1 Score: 68.9 bits (167), Expect = 2.9e-11 Identity = 37/91 (40.66%), Postives = 53/91 (58.24%), Query Frame = 0
BLAST of IVF0025321 vs. ExPASy Swiss-Prot
Match: F8WKW1 (7-deoxyloganetin glucosyltransferase OS=Gardenia jasminoides OX=114476 GN=UGT85A24 PE=1 SV=1) HSP 1 Score: 67.0 bits (162), Expect = 1.1e-10 Identity = 39/89 (43.82%), Postives = 51/89 (57.30%), Query Frame = 0
BLAST of IVF0025321 vs. ExPASy Swiss-Prot
Match: Q6VAA4 (UDP-glycosyltransferase 85C1 OS=Stevia rebaudiana OX=55670 GN=UGT85C1 PE=2 SV=1) HSP 1 Score: 65.9 bits (159), Expect = 2.4e-10 Identity = 36/89 (40.45%), Postives = 52/89 (58.43%), Query Frame = 0
BLAST of IVF0025321 vs. ExPASy Swiss-Prot
Match: Q9LMF1 (UDP-glycosyltransferase 85A3 OS=Arabidopsis thaliana OX=3702 GN=UGT85A3 PE=2 SV=2) HSP 1 Score: 65.1 bits (157), Expect = 4.2e-10 Identity = 35/91 (38.46%), Postives = 52/91 (57.14%), Query Frame = 0
BLAST of IVF0025321 vs. ExPASy TrEMBL
Match: A0A5D3C9C2 (Glycosyltransferase OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold13G002360 PE=3 SV=1) HSP 1 Score: 117.1 bits (292), Expect = 3.4e-23 Identity = 59/89 (66.29%), Postives = 64/89 (71.91%), Query Frame = 0
BLAST of IVF0025321 vs. ExPASy TrEMBL
Match: A0A5D3C6K1 (Glycosyltransferase OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold13G002320 PE=3 SV=1) HSP 1 Score: 115.2 bits (287), Expect = 1.3e-22 Identity = 59/89 (66.29%), Postives = 64/89 (71.91%), Query Frame = 0
BLAST of IVF0025321 vs. ExPASy TrEMBL
Match: A0A5A7SMQ1 (Glycosyltransferase OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold139G002330 PE=3 SV=1) HSP 1 Score: 115.2 bits (287), Expect = 1.3e-22 Identity = 58/89 (65.17%), Postives = 63/89 (70.79%), Query Frame = 0
BLAST of IVF0025321 vs. ExPASy TrEMBL
Match: A0A1S3C1J4 (Glycosyltransferase OS=Cucumis melo OX=3656 GN=LOC103495412 PE=3 SV=1) HSP 1 Score: 115.2 bits (287), Expect = 1.3e-22 Identity = 58/89 (65.17%), Postives = 63/89 (70.79%), Query Frame = 0
BLAST of IVF0025321 vs. ExPASy TrEMBL
Match: A0A1S3C0B9 (Glycosyltransferase OS=Cucumis melo OX=3656 GN=LOC103495416 PE=3 SV=1) HSP 1 Score: 115.2 bits (287), Expect = 1.3e-22 Identity = 59/89 (66.29%), Postives = 64/89 (71.91%), Query Frame = 0
BLAST of IVF0025321 vs. NCBI nr
Match: TYK06926.1 (7-deoxyloganetin glucosyltransferase-like [Cucumis melo var. makuwa]) HSP 1 Score: 117 bits (292), Expect = 1.21e-28 Identity = 59/89 (66.29%), Postives = 64/89 (71.91%), Query Frame = 0
BLAST of IVF0025321 vs. NCBI nr
Match: KAA0031473.1 (7-deoxyloganetin glucosyltransferase-like [Cucumis melo var. makuwa]) HSP 1 Score: 115 bits (287), Expect = 6.22e-28 Identity = 58/89 (65.17%), Postives = 63/89 (70.79%), Query Frame = 0
BLAST of IVF0025321 vs. NCBI nr
Match: XP_008455194.1 (PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Cucumis melo] >KAA0031469.1 7-deoxyloganetin glucosyltransferase-like [Cucumis melo var. makuwa] >TYK06922.1 7-deoxyloganetin glucosyltransferase-like [Cucumis melo var. makuwa]) HSP 1 Score: 115 bits (287), Expect = 6.68e-28 Identity = 59/89 (66.29%), Postives = 64/89 (71.91%), Query Frame = 0
BLAST of IVF0025321 vs. NCBI nr
Match: XP_008455180.1 (PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Cucumis melo]) HSP 1 Score: 115 bits (287), Expect = 6.73e-28 Identity = 58/89 (65.17%), Postives = 63/89 (70.79%), Query Frame = 0
BLAST of IVF0025321 vs. NCBI nr
Match: XP_016901691.1 (PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Cucumis melo]) HSP 1 Score: 113 bits (282), Expect = 3.42e-27 Identity = 60/90 (66.67%), Postives = 65/90 (72.22%), Query Frame = 0
BLAST of IVF0025321 vs. TAIR 10
Match: AT1G22370.1 (UDP-glucosyl transferase 85A5 ) HSP 1 Score: 68.9 bits (167), Expect = 2.1e-12 Identity = 37/91 (40.66%), Postives = 53/91 (58.24%), Query Frame = 0
BLAST of IVF0025321 vs. TAIR 10
Match: AT1G22370.2 (UDP-glucosyl transferase 85A5 ) HSP 1 Score: 68.9 bits (167), Expect = 2.1e-12 Identity = 37/91 (40.66%), Postives = 53/91 (58.24%), Query Frame = 0
BLAST of IVF0025321 vs. TAIR 10
Match: AT1G22380.1 (UDP-glucosyl transferase 85A3 ) HSP 1 Score: 65.1 bits (157), Expect = 3.0e-11 Identity = 35/91 (38.46%), Postives = 52/91 (57.14%), Query Frame = 0
BLAST of IVF0025321 vs. TAIR 10
Match: AT1G22360.1 (UDP-glucosyl transferase 85A2 ) HSP 1 Score: 64.7 bits (156), Expect = 3.9e-11 Identity = 34/91 (37.36%), Postives = 55/91 (60.44%), Query Frame = 0
BLAST of IVF0025321 vs. TAIR 10
Match: AT1G22360.2 (UDP-glucosyl transferase 85A2 ) HSP 1 Score: 64.7 bits (156), Expect = 3.9e-11 Identity = 34/91 (37.36%), Postives = 55/91 (60.44%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (IVF77) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|