IVF0025163 (gene) Melon (IVF77) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAGGTACCAATTATATTTAACTACATGCACCAATATATCCTTGTTAATTTATGTCTATATACTATTTAGTAAGAGGCCGGAATATATTAGCTAATTTATTTGTTATTTGGTTTGTTTTGCATACATTGTTCAGACAGTTGAGTTGAAAGTAGAGATGGTGGGAATCCATGAGAAAAGGCTGCGAAAATGTCTATCAAAGTTGAAAGGTAAAGCAAAAACGACGACTGAACTCCCAATAATTGGAAGAATTGATTTAAGAATTATATTAGGTAGCCATTTAGTGTATTGAATAATAATGATGAATATTGTGAATGAAATTGGGCAGGGGTGGAGAAAGTGGAGGTTGATGCAAACAGCCAGAAGGTGGCGGTGAGCAGCTACATTCACCGGAACAAGATACTGAAAGCGATTAGAAGAAGTGGTTTGAAAGCTGATTTTTGGTCAGCTCAAAACGAGCTTCTTAATGCATATGCCACCACTTATGGCGCCTTCAGATTCTCTCCCTACAACTCCTTCTTCTAG ATGGAGACAGTTGAGTTGAAAGTAGAGATGGTGGGAATCCATGAGAAAAGGCTGCGAAAATGTCTATCAAAGTTGAAAGGGGTGGAGAAAGTGGAGGTTGATGCAAACAGCCAGAAGGTGGCGGTGAGCAGCTACATTCACCGGAACAAGATACTGAAAGCGATTAGAAGAAGTGGTTTGAAAGCTGATTTTTGGTCAGCTCAAAACGAGCTTCTTAATGCATATGCCACCACTTATGGCGCCTTCAGATTCTCTCCCTACAACTCCTTCTTCTAG ATGGAGACAGTTGAGTTGAAAGTAGAGATGGTGGGAATCCATGAGAAAAGGCTGCGAAAATGTCTATCAAAGTTGAAAGGGGTGGAGAAAGTGGAGGTTGATGCAAACAGCCAGAAGGTGGCGGTGAGCAGCTACATTCACCGGAACAAGATACTGAAAGCGATTAGAAGAAGTGGTTTGAAAGCTGATTTTTGGTCAGCTCAAAACGAGCTTCTTAATGCATATGCCACCACTTATGGCGCCTTCAGATTCTCTCCCTACAACTCCTTCTTCTAG METVELKVEMVGIHEKRLRKCLSKLKGVEKVEVDANSQKVAVSSYIHRNKILKAIRRSGLKADFWSAQNELLNAYATTYGAFRFSPYNSFF Homology
BLAST of IVF0025163 vs. ExPASy Swiss-Prot
Match: F4JMB8 (Heavy metal-associated isoprenylated plant protein 44 OS=Arabidopsis thaliana OX=3702 GN=HIPP44 PE=2 SV=1) HSP 1 Score: 58.2 bits (139), Expect = 5.8e-08 Identity = 32/65 (49.23%), Postives = 45/65 (69.23%), Query Frame = 0
BLAST of IVF0025163 vs. ExPASy Swiss-Prot
Match: B3H6D0 (Heavy metal-associated isoprenylated plant protein 45 OS=Arabidopsis thaliana OX=3702 GN=HIPP45 PE=3 SV=1) HSP 1 Score: 56.6 bits (135), Expect = 1.7e-07 Identity = 28/66 (42.42%), Postives = 46/66 (69.70%), Query Frame = 0
BLAST of IVF0025163 vs. ExPASy Swiss-Prot
Match: F4IQG4 (Heavy metal-associated isoprenylated plant protein 30 OS=Arabidopsis thaliana OX=3702 GN=HIPP30 PE=1 SV=1) HSP 1 Score: 56.2 bits (134), Expect = 2.2e-07 Identity = 27/66 (40.91%), Postives = 46/66 (69.70%), Query Frame = 0
BLAST of IVF0025163 vs. ExPASy Swiss-Prot
Match: Q9C9A3 (Heavy metal-associated isoprenylated plant protein 20 OS=Arabidopsis thaliana OX=3702 GN=HIPP20 PE=1 SV=1) HSP 1 Score: 55.5 bits (132), Expect = 3.8e-07 Identity = 32/83 (38.55%), Postives = 48/83 (57.83%), Query Frame = 0
BLAST of IVF0025163 vs. ExPASy Swiss-Prot
Match: F4IC29 (Heavy metal-associated isoprenylated plant protein 28 OS=Arabidopsis thaliana OX=3702 GN=HIPP28 PE=3 SV=1) HSP 1 Score: 55.5 bits (132), Expect = 3.8e-07 Identity = 27/67 (40.30%), Postives = 46/67 (68.66%), Query Frame = 0
BLAST of IVF0025163 vs. ExPASy TrEMBL
Match: A0A5D3D8M2 (Copper transport protein ATX1-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold134G00370 PE=4 SV=1) HSP 1 Score: 177.6 bits (449), Expect = 2.4e-41 Identity = 91/91 (100.00%), Postives = 91/91 (100.00%), Query Frame = 0
BLAST of IVF0025163 vs. ExPASy TrEMBL
Match: A0A1S3BVZ7 (copper transport protein ATX1-like OS=Cucumis melo OX=3656 GN=LOC103493846 PE=4 SV=1) HSP 1 Score: 177.6 bits (449), Expect = 2.4e-41 Identity = 91/91 (100.00%), Postives = 91/91 (100.00%), Query Frame = 0
BLAST of IVF0025163 vs. ExPASy TrEMBL
Match: A0A6J1FR32 (heavy metal-associated isoprenylated plant protein 30-like OS=Cucurbita moschata OX=3662 GN=LOC111446149 PE=4 SV=1) HSP 1 Score: 162.5 bits (410), Expect = 8.1e-37 Identity = 82/91 (90.11%), Postives = 86/91 (94.51%), Query Frame = 0
BLAST of IVF0025163 vs. ExPASy TrEMBL
Match: A0A6J1IV94 (heavy metal-associated isoprenylated plant protein 30-like OS=Cucurbita maxima OX=3661 GN=LOC111480911 PE=4 SV=1) HSP 1 Score: 162.2 bits (409), Expect = 1.1e-36 Identity = 82/91 (90.11%), Postives = 86/91 (94.51%), Query Frame = 0
BLAST of IVF0025163 vs. ExPASy TrEMBL
Match: A0A0A0L1F1 (HMA domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_4G664450 PE=4 SV=1) HSP 1 Score: 162.2 bits (409), Expect = 1.1e-36 Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 0
BLAST of IVF0025163 vs. NCBI nr
Match: XP_004145605.1 (heavy metal-associated isoprenylated plant protein 44 [Cucumis sativus] >XP_008453015.1 PREDICTED: copper transport protein ATX1-like [Cucumis melo] >KAA0064666.1 copper transport protein ATX1-like [Cucumis melo var. makuwa] >KAE8649967.1 hypothetical protein Csa_012143 [Cucumis sativus] >TYK19925.1 copper transport protein ATX1-like [Cucumis melo var. makuwa]) HSP 1 Score: 178 bits (451), Expect = 3.72e-56 Identity = 91/91 (100.00%), Postives = 91/91 (100.00%), Query Frame = 0
BLAST of IVF0025163 vs. NCBI nr
Match: XP_038896838.1 (heavy metal-associated isoprenylated plant protein 44-like [Benincasa hispida]) HSP 1 Score: 175 bits (443), Expect = 6.19e-55 Identity = 89/91 (97.80%), Postives = 90/91 (98.90%), Query Frame = 0
BLAST of IVF0025163 vs. NCBI nr
Match: XP_022940605.1 (heavy metal-associated isoprenylated plant protein 30-like [Cucurbita moschata]) HSP 1 Score: 163 bits (412), Expect = 3.32e-50 Identity = 82/91 (90.11%), Postives = 86/91 (94.51%), Query Frame = 0
BLAST of IVF0025163 vs. NCBI nr
Match: XP_022981912.1 (heavy metal-associated isoprenylated plant protein 30-like [Cucurbita maxima] >KAG6608655.1 Heavy metal-associated isoprenylated plant protein 45, partial [Cucurbita argyrosperma subsp. sororia] >KAG7037973.1 Heavy metal-associated isoprenylated plant protein 45 [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 162 bits (411), Expect = 4.72e-50 Identity = 82/91 (90.11%), Postives = 86/91 (94.51%), Query Frame = 0
BLAST of IVF0025163 vs. NCBI nr
Match: XP_023524518.1 (heavy metal-associated isoprenylated plant protein 30-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 160 bits (405), Expect = 3.89e-49 Identity = 81/91 (89.01%), Postives = 85/91 (93.41%), Query Frame = 0
BLAST of IVF0025163 vs. TAIR 10
Match: AT4G10465.1 (Heavy metal transport/detoxification superfamily protein ) HSP 1 Score: 58.2 bits (139), Expect = 4.1e-09 Identity = 32/65 (49.23%), Postives = 45/65 (69.23%), Query Frame = 0
BLAST of IVF0025163 vs. TAIR 10
Match: AT3G56891.1 (Heavy metal transport/detoxification superfamily protein ) HSP 1 Score: 56.6 bits (135), Expect = 1.2e-08 Identity = 28/66 (42.42%), Postives = 46/66 (69.70%), Query Frame = 0
BLAST of IVF0025163 vs. TAIR 10
Match: AT2G18196.1 (Heavy metal transport/detoxification superfamily protein ) HSP 1 Score: 56.2 bits (134), Expect = 1.6e-08 Identity = 27/66 (40.91%), Postives = 46/66 (69.70%), Query Frame = 0
BLAST of IVF0025163 vs. TAIR 10
Match: AT1G71050.1 (Heavy metal transport/detoxification superfamily protein ) HSP 1 Score: 55.5 bits (132), Expect = 2.7e-08 Identity = 32/83 (38.55%), Postives = 48/83 (57.83%), Query Frame = 0
BLAST of IVF0025163 vs. TAIR 10
Match: AT1G06330.1 (Heavy metal transport/detoxification superfamily protein ) HSP 1 Score: 55.5 bits (132), Expect = 2.7e-08 Identity = 27/67 (40.30%), Postives = 46/67 (68.66%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (IVF77) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|