IVF0024350 (gene) Melon (IVF77) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonfive_prime_UTRpolypeptideCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.ACGGCGGCGAAATGGAGAAGGCGCTGAGAGTATATGGAGAAGTTTTGAGGTTAGTGAGGCGGTTACCTAAGGACACAAGGCCTTACTACGCCAAATACGCTAGAGAGAATTTCGTCAACTACAGAGAGGTCGATGCCAACGATGCAAAATCCCTAGAAGAACTCTTCCACAGAGCTTACAATCACTCCCTTTGGGTTCTGAACAAGGTTTTAACTCTTGAATTCTCTGATCTTGAATTTGTTCGTTCGTTTGTTTGTTTTGTTTTCCATGTGTTTTAGAGGTTGTGGTGATTGGCAGTATTCGGTGGATGGATCTGCGGCGGATAAGCTGAAGGAGATCTGTTATAGTTAGTGGTGGGGGGTGGGGGAAGAAGTGAATAGAATTCATTAGGGGTAGGGAAGTGGAGGATTATGGGTTCATAAAGAGAAAGTGAGGACGTAAATTGATCTGATTTTGAGTGTTGTTGGATTTGTGTAAAAATAAAGACTAAAGAAGAGAAGAGAAGAGAAGAGAAGAGAGGTGGTGTCTCTATACTTCATGTTTCTAACTTTGTATCCATTTGTGGATCCACA ACGGCGGCGAAATGGAGAAGGCGCTGAGAGTATATGGAGAAGTTTTGAGGTTAGTGAGGCGGTTACCTAAGGACACAAGGCCTTACTACGCCAAATACGCTAGAGAGAATTTCGTCAACTACAGAGAGGTCGATGCCAACGATGCAAAATCCCTAGAAGAACTCTTCCACAGAGCTTACAATCACTCCCTTTGGGTTCTGAACAAGTATTCGGTGGATGGATCTGCGGCGGATAAGCTGAAGGAGATCTGTTATAGTTAGTGGTGGGGGGTGGGGGAAGAAGTGAATAGAATTCATTAGGGGTAGGGAAGTGGAGGATTATGGGTTCATAAAGAGAAAGTGAGGACGTAAATTGATCTGATTTTGAGTGTTGTTGGATTTGTGTAAAAATAAAGACTAAAGAAGAGAAGAGAAGAGAAGAGAAGAGAGGTGGTGTCTCTATACTTCATGTTTCTAACTTTGTATCCATTTGTGGATCCACA ATGGAGAAGGCGCTGAGAGTATATGGAGAAGTTTTGAGGTTAGTGAGGCGGTTACCTAAGGACACAAGGCCTTACTACGCCAAATACGCTAGAGAGAATTTCGTCAACTACAGAGAGGTCGATGCCAACGATGCAAAATCCCTAGAAGAACTCTTCCACAGAGCTTACAATCACTCCCTTTGGGTTCTGAACAAGTATTCGGTGGATGGATCTGCGGCGGATAAGCTGAAGGAGATCTGTTATAGTTAG MEKALRVYGEVLRLVRRLPKDTRPYYAKYARENFVNYREVDANDAKSLEELFHRAYNHSLWVLNKYSVDGSAADKLKEICYS Homology
BLAST of IVF0024350 vs. ExPASy Swiss-Prot
Match: Q1G3M2 (LYR motif-containing protein At3g19508 OS=Arabidopsis thaliana OX=3702 GN=At3g19508 PE=3 SV=1) HSP 1 Score: 127.9 bits (320), Expect = 5.4e-29 Identity = 62/81 (76.54%), Postives = 70/81 (86.42%), Query Frame = 0
BLAST of IVF0024350 vs. ExPASy Swiss-Prot
Match: A9SNJ1 (LYR motif-containing protein PHYPADRAFT_186863 OS=Physcomitrium patens OX=3218 GN=PHYPADRAFT_186863 PE=3 SV=1) HSP 1 Score: 66.6 bits (161), Expect = 1.5e-10 Identity = 32/60 (53.33%), Postives = 43/60 (71.67%), Query Frame = 0
BLAST of IVF0024350 vs. ExPASy TrEMBL
Match: A0A5A7T6G8 (LYR motif-containing protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold832G00680 PE=4 SV=1) HSP 1 Score: 170.2 bits (430), Expect = 3.5e-39 Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 0
BLAST of IVF0024350 vs. ExPASy TrEMBL
Match: A0A1S3C3W4 (LYR motif-containing protein At3g19508 OS=Cucumis melo OX=3656 GN=LOC103496191 PE=4 SV=1) HSP 1 Score: 170.2 bits (430), Expect = 3.5e-39 Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 0
BLAST of IVF0024350 vs. ExPASy TrEMBL
Match: A0A0A0L970 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G199560 PE=4 SV=1) HSP 1 Score: 163.3 bits (412), Expect = 4.3e-37 Identity = 78/81 (96.30%), Postives = 79/81 (97.53%), Query Frame = 0
BLAST of IVF0024350 vs. ExPASy TrEMBL
Match: A0A6J1FPX9 (LYR motif-containing protein At3g19508 OS=Cucurbita moschata OX=3662 GN=LOC111447159 PE=4 SV=1) HSP 1 Score: 159.5 bits (402), Expect = 6.1e-36 Identity = 76/82 (92.68%), Postives = 80/82 (97.56%), Query Frame = 0
BLAST of IVF0024350 vs. ExPASy TrEMBL
Match: A0A6P4A9N6 (LYR motif-containing protein At3g19508 OS=Ziziphus jujuba OX=326968 GN=LOC107427002 PE=4 SV=1) HSP 1 Score: 158.7 bits (400), Expect = 1.0e-35 Identity = 73/82 (89.02%), Postives = 80/82 (97.56%), Query Frame = 0
BLAST of IVF0024350 vs. NCBI nr
Match: XP_008456173.1 (PREDICTED: LYR motif-containing protein At3g19508 [Cucumis melo] >KAA0037191.1 LYR motif-containing protein [Cucumis melo var. makuwa] >TYK13881.1 LYR motif-containing protein [Cucumis melo var. makuwa]) HSP 1 Score: 168 bits (425), Expect = 1.81e-52 Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 0
BLAST of IVF0024350 vs. NCBI nr
Match: XP_038898400.1 (LYR motif-containing protein At3g19508 [Benincasa hispida]) HSP 1 Score: 164 bits (414), Expect = 8.63e-51 Identity = 79/82 (96.34%), Postives = 81/82 (98.78%), Query Frame = 0
BLAST of IVF0024350 vs. NCBI nr
Match: XP_004140718.1 (LYR motif-containing protein At3g19508 [Cucumis sativus] >KGN57494.1 hypothetical protein Csa_011093 [Cucumis sativus]) HSP 1 Score: 161 bits (407), Expect = 1.01e-49 Identity = 78/81 (96.30%), Postives = 79/81 (97.53%), Query Frame = 0
BLAST of IVF0024350 vs. NCBI nr
Match: XP_022941949.1 (LYR motif-containing protein At3g19508 [Cucurbita moschata] >XP_023512988.1 LYR motif-containing protein At3g19508 [Cucurbita pepo subsp. pepo] >KAG6600304.1 LYR motif-containing protein, partial [Cucurbita argyrosperma subsp. sororia] >KAG7030964.1 LYR motif-containing protein [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 157 bits (397), Expect = 3.49e-48 Identity = 76/82 (92.68%), Postives = 80/82 (97.56%), Query Frame = 0
BLAST of IVF0024350 vs. NCBI nr
Match: XP_015892821.1 (LYR motif-containing protein At3g19508 [Ziziphus jujuba]) HSP 1 Score: 156 bits (395), Expect = 6.85e-48 Identity = 73/82 (89.02%), Postives = 80/82 (97.56%), Query Frame = 0
BLAST of IVF0024350 vs. TAIR 10
Match: AT3G19508.1 (unknown protein; LOCATED IN: mitochondrion; Has 34 Blast hits to 34 proteins in 14 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 34; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). ) HSP 1 Score: 127.9 bits (320), Expect = 3.8e-30 Identity = 62/81 (76.54%), Postives = 70/81 (86.42%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (IVF77) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
|