![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
IVF0024117 (gene) Melon (IVF77) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGAATCCACTGATTTCTGCCGCTTCCGTTATTGCTGCTGGGTTGGCCGTCGGGCTTGCTTCTATTGGACCTGGGATTGGTCAAGGTACTGCTGCGGGCCAAGCTGTAGAAGGGATCGCGAGACAACCCGAGGCGGAGGGAAAAATCCGAGGTACTTGA ATGAATCCACTGATTTCTGCCGCTTCCGTTATTGCTGCTGGGTTGGCCGTCGGGCTTGCTTCTATTGGACCTGGGATTGGTCAAGGTACTGCTGCGGGCCAAGCTGTAGAAGGGATCGCGAGACAACCCGAGGCGGAGGGAAAAATCCGAGGTACTTGA ATGAATCCACTGATTTCTGCCGCTTCCGTTATTGCTGCTGGGTTGGCCGTCGGGCTTGCTTCTATTGGACCTGGGATTGGTCAAGGTACTGCTGCGGGCCAAGCTGTAGAAGGGATCGCGAGACAACCCGAGGCGGAGGGAAAAATCCGAGGTACTTGA MNPLISAASVIAAGLAVGLASIGPGIGQGTAAGQAVEGIARQPEAEGKIRGT Homology
BLAST of IVF0024117 vs. ExPASy Swiss-Prot
Match: Q6WQW2 (ATP synthase subunit c, chloroplastic OS=Cucumis sativus OX=3659 GN=atpH PE=3 SV=1) HSP 1 Score: 94.0 bits (232), Expect = 5.4e-19 Identity = 52/52 (100.00%), Postives = 52/52 (100.00%), Query Frame = 0
BLAST of IVF0024117 vs. ExPASy Swiss-Prot
Match: P62481 (ATP synthase subunit c, chloroplastic OS=Marchantia polymorpha OX=3197 GN=atpH PE=3 SV=1) HSP 1 Score: 94.0 bits (232), Expect = 5.4e-19 Identity = 52/52 (100.00%), Postives = 52/52 (100.00%), Query Frame = 0
BLAST of IVF0024117 vs. ExPASy Swiss-Prot
Match: B0Z4N0 (ATP synthase subunit c, chloroplastic OS=Oenothera argillicola OX=3940 GN=atpH PE=3 SV=1) HSP 1 Score: 94.0 bits (232), Expect = 5.4e-19 Identity = 52/52 (100.00%), Postives = 52/52 (100.00%), Query Frame = 0
BLAST of IVF0024117 vs. ExPASy Swiss-Prot
Match: B0Z4W4 (ATP synthase subunit c, chloroplastic OS=Oenothera biennis OX=3942 GN=atpH PE=3 SV=1) HSP 1 Score: 94.0 bits (232), Expect = 5.4e-19 Identity = 52/52 (100.00%), Postives = 52/52 (100.00%), Query Frame = 0
BLAST of IVF0024117 vs. ExPASy Swiss-Prot
Match: P62480 (ATP synthase subunit c, chloroplastic OS=Oenothera elata subsp. hookeri OX=85636 GN=atpH PE=3 SV=1) HSP 1 Score: 94.0 bits (232), Expect = 5.4e-19 Identity = 52/52 (100.00%), Postives = 52/52 (100.00%), Query Frame = 0
BLAST of IVF0024117 vs. ExPASy TrEMBL
Match: A0A0U2UJ76 (ATP synthase subunit c, chloroplastic OS=Oenothera oakesiana OX=482602 GN=atpH PE=3 SV=1) HSP 1 Score: 94.0 bits (232), Expect = 2.0e-16 Identity = 52/52 (100.00%), Postives = 52/52 (100.00%), Query Frame = 0
BLAST of IVF0024117 vs. ExPASy TrEMBL
Match: U6A3L6 (ATP synthase F0 sector subunit C OS=Monocostus uniflorus OX=4634 GN=atpH PE=3 SV=1) HSP 1 Score: 94.0 bits (232), Expect = 2.0e-16 Identity = 52/52 (100.00%), Postives = 52/52 (100.00%), Query Frame = 0
BLAST of IVF0024117 vs. ExPASy TrEMBL
Match: A0A218KG23 (ATP synthase subunit c, chloroplastic OS=Cucumis sativus var. hardwickii OX=319220 GN=atpH PE=3 SV=1) HSP 1 Score: 94.0 bits (232), Expect = 2.0e-16 Identity = 52/52 (100.00%), Postives = 52/52 (100.00%), Query Frame = 0
BLAST of IVF0024117 vs. ExPASy TrEMBL
Match: A0A0U2SNX2 (ATP synthase subunit c, chloroplastic OS=Oenothera grandiflora OX=49455 GN=atpH PE=3 SV=1) HSP 1 Score: 94.0 bits (232), Expect = 2.0e-16 Identity = 52/52 (100.00%), Postives = 52/52 (100.00%), Query Frame = 0
BLAST of IVF0024117 vs. ExPASy TrEMBL
Match: A0A482CGV6 (ATP synthase F0 sector subunit C OS=Solanum violaceimarmoratum OX=315348 GN=atpH PE=3 SV=1) HSP 1 Score: 94.0 bits (232), Expect = 2.0e-16 Identity = 52/52 (100.00%), Postives = 52/52 (100.00%), Query Frame = 0
BLAST of IVF0024117 vs. NCBI nr
Match: KAG6540592.1 (hypothetical protein Mapa_018107 [Marchantia paleacea]) HSP 1 Score: 94.4 bits (233), Expect = 6.03e-24 Identity = 52/52 (100.00%), Postives = 52/52 (100.00%), Query Frame = 0
BLAST of IVF0024117 vs. NCBI nr
Match: DAD43601.1 (TPA_asm: hypothetical protein HUJ06_001831 [Nelumbo nucifera]) HSP 1 Score: 94.0 bits (232), Expect = 6.84e-24 Identity = 51/52 (98.08%), Postives = 52/52 (100.00%), Query Frame = 0
BLAST of IVF0024117 vs. NCBI nr
Match: AHM88892.1 (ATP synthase CF0 subunit III, partial [Lagenaria siceraria]) HSP 1 Score: 94.0 bits (232), Expect = 9.77e-24 Identity = 51/52 (98.08%), Postives = 52/52 (100.00%), Query Frame = 0
BLAST of IVF0024117 vs. NCBI nr
Match: ARV78259.1 (ATP synthase CF0 C subunit [Aneura pinguis] >ASN73860.1 ATP synthase CF0 C subunit [Aneura pinguis]) HSP 1 Score: 94.4 bits (233), Expect = 9.78e-24 Identity = 52/52 (100.00%), Postives = 52/52 (100.00%), Query Frame = 0
BLAST of IVF0024117 vs. NCBI nr
Match: YP_009682225.1 (ATP synthase CF0 subunit III [Fissidens nobilis] >YP_009867577.1 ATP synthase CF0 subunit III [Drepanocladus aduncus] >QDQ38697.1 ATP synthase CF0 subunit III [Fissidens nobilis] >QKG04822.1 ATP synthase CF0 subunit III [Drepanocladus aduncus]) HSP 1 Score: 94.4 bits (233), Expect = 9.78e-24 Identity = 52/52 (100.00%), Postives = 52/52 (100.00%), Query Frame = 0
BLAST of IVF0024117 vs. TAIR 10
Match: ATCG00140.1 (ATP synthase subunit C family protein ) HSP 1 Score: 93.2 bits (230), Expect = 6.6e-20 Identity = 50/52 (96.15%), Postives = 52/52 (100.00%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (IVF77) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|