IVF0022751 (gene) Melon (IVF77) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTGAGAGGAAAGACACAGATGAGGTTAATAGAGAACGCTACAAGCCGTCAAGTCACCTTCTCCAAGAGGAGAAATGGTTTGATGAAAAAAGCTTTTGAGTTATCGGTTCTCTGTGATGCTGAAGTTGCTCTTATCATCTTCTCCCCTAGAGGAAAGCTTTATGAATTTGCTAGCTCAAGGTAACTTTTTTTTTTTTTTTTTTAAATCTCTAGCTCTATTCTTTTTGTTACCAATTTTAGCGTGATGGATTGTGATCTGAATTTGAATCTGATCTAA ATGGTGAGAGGAAAGACACAGATGAGGTTAATAGAGAACGCTACAAGCCGTCAAGTCACCTTCTCCAAGAGGAGAAATGGTTTGATGAAAAAAGCTTTTGAGTTATCGGTTCTCTGTGATGCTGAAGTTGCTCTTATCATCTTCTCCCCTAGAGGAAAGCTTTATGAATTTGCTAGCTCAAGCGTGATGGATTGTGATCTGAATTTGAATCTGATCTAA ATGGTGAGAGGAAAGACACAGATGAGGTTAATAGAGAACGCTACAAGCCGTCAAGTCACCTTCTCCAAGAGGAGAAATGGTTTGATGAAAAAAGCTTTTGAGTTATCGGTTCTCTGTGATGCTGAAGTTGCTCTTATCATCTTCTCCCCTAGAGGAAAGCTTTATGAATTTGCTAGCTCAAGCGTGATGGATTGTGATCTGAATTTGAATCTGATCTAA MVRGKTQMRLIENATSRQVTFSKRRNGLMKKAFELSVLCDAEVALIIFSPRGKLYEFASSSVMDCDLNLNLI Homology
BLAST of IVF0022751 vs. ExPASy Swiss-Prot
Match: O64645 (MADS-box protein SOC1 OS=Arabidopsis thaliana OX=3702 GN=SOC1 PE=1 SV=1) HSP 1 Score: 113.6 bits (283), Expect = 9.2e-25 Identity = 56/64 (87.50%), Postives = 62/64 (96.88%), Query Frame = 0
BLAST of IVF0022751 vs. ExPASy Swiss-Prot
Match: Q38838 (Agamous-like MADS-box protein AGL14 OS=Arabidopsis thaliana OX=3702 GN=AGL14 PE=1 SV=2) HSP 1 Score: 112.1 bits (279), Expect = 2.7e-24 Identity = 56/61 (91.80%), Postives = 60/61 (98.36%), Query Frame = 0
BLAST of IVF0022751 vs. ExPASy Swiss-Prot
Match: Q9XJ60 (MADS-box transcription factor 50 OS=Oryza sativa subsp. japonica OX=39947 GN=MADS50 PE=2 SV=1) HSP 1 Score: 110.9 bits (276), Expect = 6.0e-24 Identity = 55/61 (90.16%), Postives = 59/61 (96.72%), Query Frame = 0
BLAST of IVF0022751 vs. ExPASy Swiss-Prot
Match: O82743 (Agamous-like MADS-box protein AGL19 OS=Arabidopsis thaliana OX=3702 GN=AGL19 PE=1 SV=1) HSP 1 Score: 110.2 bits (274), Expect = 1.0e-23 Identity = 54/62 (87.10%), Postives = 60/62 (96.77%), Query Frame = 0
BLAST of IVF0022751 vs. ExPASy Swiss-Prot
Match: A2Z9Q7 (MADS-box transcription factor 56 OS=Oryza sativa subsp. indica OX=39946 GN=MADS56 PE=2 SV=2) HSP 1 Score: 104.4 bits (259), Expect = 5.6e-22 Identity = 50/60 (83.33%), Postives = 58/60 (96.67%), Query Frame = 0
BLAST of IVF0022751 vs. ExPASy TrEMBL
Match: A0A6P8CZN4 (MADS-box protein SOC1-like OS=Punica granatum OX=22663 GN=LOC116202227 PE=4 SV=1) HSP 1 Score: 119.0 bits (297), Expect = 8.1e-24 Identity = 60/64 (93.75%), Postives = 62/64 (96.88%), Query Frame = 0
BLAST of IVF0022751 vs. ExPASy TrEMBL
Match: A0A6J1CRU8 (MADS-box protein SOC1 OS=Momordica charantia OX=3673 GN=LOC111013696 PE=4 SV=1) HSP 1 Score: 119.0 bits (297), Expect = 8.1e-24 Identity = 61/62 (98.39%), Postives = 62/62 (100.00%), Query Frame = 0
BLAST of IVF0022751 vs. ExPASy TrEMBL
Match: A0A218VY28 (Uncharacterized protein OS=Punica granatum OX=22663 GN=CDL15_Pgr028698 PE=4 SV=1) HSP 1 Score: 119.0 bits (297), Expect = 8.1e-24 Identity = 60/64 (93.75%), Postives = 62/64 (96.88%), Query Frame = 0
BLAST of IVF0022751 vs. ExPASy TrEMBL
Match: A0A2I0JKX1 (Uncharacterized protein OS=Punica granatum OX=22663 GN=CRG98_022680 PE=4 SV=1) HSP 1 Score: 119.0 bits (297), Expect = 8.1e-24 Identity = 60/64 (93.75%), Postives = 62/64 (96.88%), Query Frame = 0
BLAST of IVF0022751 vs. ExPASy TrEMBL
Match: A0A1S3CD40 (MADS-box protein SOC1-like OS=Cucumis melo OX=3656 GN=LOC103499042 PE=4 SV=1) HSP 1 Score: 119.0 bits (297), Expect = 8.1e-24 Identity = 61/62 (98.39%), Postives = 62/62 (100.00%), Query Frame = 0
BLAST of IVF0022751 vs. NCBI nr
Match: TYK24488.1 (MADS-box protein SOC1-like [Cucumis melo var. makuwa]) HSP 1 Score: 119 bits (299), Expect = 1.21e-33 Identity = 61/62 (98.39%), Postives = 61/62 (98.39%), Query Frame = 0
BLAST of IVF0022751 vs. NCBI nr
Match: KAA0040014.1 (MADS-box protein SOC1-like [Cucumis melo var. makuwa]) HSP 1 Score: 118 bits (296), Expect = 3.22e-33 Identity = 60/60 (100.00%), Postives = 60/60 (100.00%), Query Frame = 0
BLAST of IVF0022751 vs. NCBI nr
Match: XP_008460142.1 (PREDICTED: MADS-box protein SOC1-like [Cucumis melo]) HSP 1 Score: 120 bits (301), Expect = 5.05e-32 Identity = 61/62 (98.39%), Postives = 62/62 (100.00%), Query Frame = 0
BLAST of IVF0022751 vs. NCBI nr
Match: OWM64980.1 (hypothetical protein CDL15_Pgr028698 [Punica granatum]) HSP 1 Score: 120 bits (300), Expect = 5.25e-32 Identity = 60/64 (93.75%), Postives = 62/64 (96.88%), Query Frame = 0
BLAST of IVF0022751 vs. NCBI nr
Match: XP_022143898.1 (MADS-box protein SOC1 [Momordica charantia]) HSP 1 Score: 120 bits (301), Expect = 5.31e-32 Identity = 61/62 (98.39%), Postives = 62/62 (100.00%), Query Frame = 0
BLAST of IVF0022751 vs. TAIR 10
Match: AT2G45660.1 (AGAMOUS-like 20 ) HSP 1 Score: 113.6 bits (283), Expect = 6.5e-26 Identity = 56/64 (87.50%), Postives = 62/64 (96.88%), Query Frame = 0
BLAST of IVF0022751 vs. TAIR 10
Match: AT4G11880.1 (AGAMOUS-like 14 ) HSP 1 Score: 112.1 bits (279), Expect = 1.9e-25 Identity = 56/61 (91.80%), Postives = 60/61 (98.36%), Query Frame = 0
BLAST of IVF0022751 vs. TAIR 10
Match: AT4G22950.1 (AGAMOUS-like 19 ) HSP 1 Score: 110.2 bits (274), Expect = 7.2e-25 Identity = 54/62 (87.10%), Postives = 60/62 (96.77%), Query Frame = 0
BLAST of IVF0022751 vs. TAIR 10
Match: AT5G62165.1 (AGAMOUS-like 42 ) HSP 1 Score: 99.4 bits (246), Expect = 1.3e-21 Identity = 48/62 (77.42%), Postives = 58/62 (93.55%), Query Frame = 0
BLAST of IVF0022751 vs. TAIR 10
Match: AT5G62165.2 (AGAMOUS-like 42 ) HSP 1 Score: 99.4 bits (246), Expect = 1.3e-21 Identity = 48/62 (77.42%), Postives = 58/62 (93.55%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (IVF77) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|