
IVF0022427 (gene) Melon (IVF77) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTCAATCCTTCTGGGAGTAACGGAAAATATAAATCCACCTTTGATTCGCTCCACATATTTGCAATGTGGAAGTCAATTGCGAGTATTTCATACTATTCAGTACTCAACTCAGTGTTCAAATTGCAACCGAGCAAAAGGCGGAATAGGGAAAGGAATGAGACACATCTTGCGACAAAAGCTACTCAAAATGAGGGGAGGAATGAAAAAGGAAAAAGTGAGCGGGCTTCTTCTCATTCTTCTTTGGCACCTACAGTAGAGATCGGAGGTATTTGGCCCCCAAAAGGGATTGGGGTTTTAGATCCTCGGCAAATCCCTTTTCTTAATATCCCTATTCTCCTTTCATCCGGAGCAGCCGTAACTTGGGCTCATCATGCTATACTCGTGGGGAAACTCTTCCACAGCAAGGACGGATGA ATGGTCAATCCTTCTGGGAGTAACGGAAAATATAAATCCACCTTTGATTCGCTCCACATATTTGCAATGTGGAAGTCAATTGCGAGTATTTCATACTATTCAGTACTCAACTCAGTGTTCAAATTGCAACCGAGCAAAAGGCGGAATAGGGAAAGGAATGAGACACATCTTGCGACAAAAGCTACTCAAAATGAGGGGAGGAATGAAAAAGGAAAAAGTGAGCGGGCTTCTTCTCATTCTTCTTTGGCACCTACAGTAGAGATCGGAGGTATTTGGCCCCCAAAAGGGATTGGGGTTTTAGATCCTCGGCAAATCCCTTTTCTTAATATCCCTATTCTCCTTTCATCCGGAGCAGCCGTAACTTGGGCTCATCATGCTATACTCGTGGGGAAACTCTTCCACAGCAAGGACGGATGA ATGGTCAATCCTTCTGGGAGTAACGGAAAATATAAATCCACCTTTGATTCGCTCCACATATTTGCAATGTGGAAGTCAATTGCGAGTATTTCATACTATTCAGTACTCAACTCAGTGTTCAAATTGCAACCGAGCAAAAGGCGGAATAGGGAAAGGAATGAGACACATCTTGCGACAAAAGCTACTCAAAATGAGGGGAGGAATGAAAAAGGAAAAAGTGAGCGGGCTTCTTCTCATTCTTCTTTGGCACCTACAGTAGAGATCGGAGGTATTTGGCCCCCAAAAGGGATTGGGGTTTTAGATCCTCGGCAAATCCCTTTTCTTAATATCCCTATTCTCCTTTCATCCGGAGCAGCCGTAACTTGGGCTCATCATGCTATACTCGTGGGGAAACTCTTCCACAGCAAGGACGGATGA MVNPSGSNGKYKSTFDSLHIFAMWKSIASISYYSVLNSVFKLQPSKRRNRERNETHLATKATQNEGRNEKGKSERASSHSSLAPTVEIGGIWPPKGIGVLDPRQIPFLNIPILLSSGAAVTWAHHAILVGKLFHSKDG Homology
BLAST of IVF0022427 vs. ExPASy Swiss-Prot
Match: Q03227 (Cytochrome c oxidase subunit 3 OS=Vicia faba OX=3906 GN=COX3 PE=3 SV=1) HSP 1 Score: 115.5 bits (288), Expect = 4.6e-25 Identity = 54/57 (94.74%), Postives = 55/57 (96.49%), Query Frame = 0
BLAST of IVF0022427 vs. ExPASy Swiss-Prot
Match: P08745 (Cytochrome c oxidase subunit 3 OS=Oenothera berteroana OX=3950 GN=COX3 PE=3 SV=2) HSP 1 Score: 110.9 bits (276), Expect = 1.1e-23 Identity = 52/56 (92.86%), Postives = 53/56 (94.64%), Query Frame = 0
BLAST of IVF0022427 vs. ExPASy Swiss-Prot
Match: P32808 (Cytochrome c oxidase subunit 3 OS=Helianthus annuus OX=4232 GN=COX3 PE=3 SV=1) HSP 1 Score: 110.5 bits (275), Expect = 1.5e-23 Identity = 52/57 (91.23%), Postives = 53/57 (92.98%), Query Frame = 0
BLAST of IVF0022427 vs. ExPASy Swiss-Prot
Match: Q36952 (Cytochrome c oxidase subunit 3 OS=Aegilops columnaris OX=4493 GN=COX3 PE=3 SV=1) HSP 1 Score: 105.9 bits (263), Expect = 3.7e-22 Identity = 50/56 (89.29%), Postives = 51/56 (91.07%), Query Frame = 0
BLAST of IVF0022427 vs. ExPASy Swiss-Prot
Match: P09138 (Cytochrome c oxidase subunit 3 OS=Zea mays OX=4577 GN=COX3 PE=2 SV=2) HSP 1 Score: 105.9 bits (263), Expect = 3.7e-22 Identity = 50/56 (89.29%), Postives = 51/56 (91.07%), Query Frame = 0
BLAST of IVF0022427 vs. ExPASy TrEMBL
Match: A0A5A7VC41 (Cytochrome c oxidase subunit 3 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold110G00250 PE=3 SV=1) HSP 1 Score: 231.9 bits (590), Expect = 1.6e-57 Identity = 116/116 (100.00%), Postives = 116/116 (100.00%), Query Frame = 0
BLAST of IVF0022427 vs. ExPASy TrEMBL
Match: A0A072TI35 (Cytochrome c oxidase subunit 3 OS=Medicago truncatula OX=3880 GN=MTR_0082s0160 PE=3 SV=1) HSP 1 Score: 115.5 bits (288), Expect = 1.7e-22 Identity = 54/57 (94.74%), Postives = 55/57 (96.49%), Query Frame = 0
BLAST of IVF0022427 vs. ExPASy TrEMBL
Match: A0A072U895 (Cytochrome c oxidase subunit 3 OS=Medicago truncatula OX=3880 GN=MTR_6g032895 PE=3 SV=1) HSP 1 Score: 115.5 bits (288), Expect = 1.7e-22 Identity = 54/57 (94.74%), Postives = 55/57 (96.49%), Query Frame = 0
BLAST of IVF0022427 vs. ExPASy TrEMBL
Match: A0A072TF83 (Cytochrome c oxidase subunit 3 (Fragment) OS=Medicago truncatula OX=3880 GN=MTR_0495s0020 PE=3 SV=1) HSP 1 Score: 115.5 bits (288), Expect = 1.7e-22 Identity = 54/57 (94.74%), Postives = 55/57 (96.49%), Query Frame = 0
BLAST of IVF0022427 vs. ExPASy TrEMBL
Match: A0A126TGU6 (Cytochrome c oxidase subunit 3 OS=Medicago truncatula OX=3880 GN=cox3 PE=3 SV=1) HSP 1 Score: 115.5 bits (288), Expect = 1.7e-22 Identity = 54/57 (94.74%), Postives = 55/57 (96.49%), Query Frame = 0
BLAST of IVF0022427 vs. NCBI nr
Match: KAA0063465.1 (cytochrome C oxidase subunit 3 [Cucumis melo var. makuwa] >TYJ95762.1 cytochrome C oxidase subunit 3 [Cucumis melo var. makuwa]) HSP 1 Score: 234 bits (598), Expect = 2.13e-77 Identity = 116/116 (100.00%), Postives = 116/116 (100.00%), Query Frame = 0
BLAST of IVF0022427 vs. NCBI nr
Match: KEH15846.1 (cytochrome C oxidase subunit 3, partial [Medicago truncatula]) HSP 1 Score: 117 bits (293), Expect = 7.57e-31 Identity = 54/57 (94.74%), Postives = 55/57 (96.49%), Query Frame = 0
BLAST of IVF0022427 vs. NCBI nr
Match: XP_039682841.1 (cytochrome c oxidase subunit 3-like [Medicago truncatula] >RHN50810.1 Cytochrome c oxidase subunit 3 [Medicago truncatula]) HSP 1 Score: 117 bits (293), Expect = 1.20e-29 Identity = 54/57 (94.74%), Postives = 55/57 (96.49%), Query Frame = 0
BLAST of IVF0022427 vs. NCBI nr
Match: KEH25606.1 (cytochrome C oxidase subunit 3 [Medicago truncatula]) HSP 1 Score: 117 bits (293), Expect = 1.53e-29 Identity = 54/57 (94.74%), Postives = 55/57 (96.49%), Query Frame = 0
BLAST of IVF0022427 vs. NCBI nr
Match: AWK59909.1 (cytochrome c oxidase subunit 3, partial [Sophora moorcroftiana]) HSP 1 Score: 117 bits (293), Expect = 2.09e-29 Identity = 54/57 (94.74%), Postives = 55/57 (96.49%), Query Frame = 0
BLAST of IVF0022427 vs. TAIR 10
Match: AT2G07687.1 (Cytochrome c oxidase, subunit III ) HSP 1 Score: 103.2 bits (256), Expect = 1.7e-22 Identity = 49/56 (87.50%), Postives = 50/56 (89.29%), Query Frame = 0
BLAST of IVF0022427 vs. TAIR 10
Match: ATMG00730.1 (cytochrome c oxidase subunit 3 ) HSP 1 Score: 103.2 bits (256), Expect = 1.7e-22 Identity = 49/56 (87.50%), Postives = 50/56 (89.29%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (IVF77) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|