IVF0021741 (gene) Melon (IVF77) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGGTTTCGTTTGCCTAGTATTGTTCACACTAAGCCAAGTCTTCAACGATCCACATCGTTAGGAAATAGAGCCACTCCAAAGTCTCTTGATGTTCCGAAAGGATGCTTTACGGTCTATGTCGGAGAAGAACAAAAGAAGCGTTTTGTCATCCCGCTATCTTACTTGAACCAACCTTTGTTTCAAAATTTGTTGAGTCAAGCTGAAGAAGAATTTGGATATGATTATCCAATGGGTGGCATCACTATTCCCTGCGATGAAGATACTTTTGTTGATATTATTCATAGTTTATGA ATGGGGTTTCGTTTGCCTAGTATTGTTCACACTAAGCCAAGTCTTCAACGATCCACATCGTTAGGAAATAGAGCCACTCCAAAGTCTCTTGATGTTCCGAAAGGATGCTTTACGGTCTATGTCGGAGAAGAACAAAAGAAGCGTTTTGTCATCCCGCTATCTTACTTGAACCAACCTTTGTTTCAAAATTTGTTGAGTCAAGCTGAAGAAGAATTTGGATATGATTATCCAATGGGTGGCATCACTATTCCCTGCGATGAAGATACTTTTGTTGATATTATTCATAGTTTATGA ATGGGGTTTCGTTTGCCTAGTATTGTTCACACTAAGCCAAGTCTTCAACGATCCACATCGTTAGGAAATAGAGCCACTCCAAAGTCTCTTGATGTTCCGAAAGGATGCTTTACGGTCTATGTCGGAGAAGAACAAAAGAAGCGTTTTGTCATCCCGCTATCTTACTTGAACCAACCTTTGTTTCAAAATTTGTTGAGTCAAGCTGAAGAAGAATTTGGATATGATTATCCAATGGGTGGCATCACTATTCCCTGCGATGAAGATACTTTTGTTGATATTATTCATAGTTTATGA MGFRLPSIVHTKPSLQRSTSLGNRATPKSLDVPKGCFTVYVGEEQKKRFVIPLSYLNQPLFQNLLSQAEEEFGYDYPMGGITIPCDEDTFVDIIHSL Homology
BLAST of IVF0021741 vs. ExPASy Swiss-Prot
Match: P32295 (Indole-3-acetic acid-induced protein ARG7 OS=Vigna radiata var. radiata OX=3916 GN=ARG7 PE=2 SV=1) HSP 1 Score: 116.7 bits (291), Expect = 1.5e-25 Identity = 60/97 (61.86%), Postives = 69/97 (71.13%), Query Frame = 0
BLAST of IVF0021741 vs. ExPASy Swiss-Prot
Match: P33080 (Auxin-induced protein X10A OS=Glycine max OX=3847 PE=2 SV=1) HSP 1 Score: 113.6 bits (283), Expect = 1.2e-24 Identity = 57/98 (58.16%), Postives = 73/98 (74.49%), Query Frame = 0
BLAST of IVF0021741 vs. ExPASy Swiss-Prot
Match: Q9FK62 (Auxin-responsive protein SAUR24 OS=Arabidopsis thaliana OX=3702 GN=SAUR24 PE=2 SV=1) HSP 1 Score: 109.0 bits (271), Expect = 3.1e-23 Identity = 51/91 (56.04%), Postives = 66/91 (72.53%), Query Frame = 0
BLAST of IVF0021741 vs. ExPASy Swiss-Prot
Match: P33081 (Auxin-induced protein 15A OS=Glycine max OX=3847 PE=2 SV=1) HSP 1 Score: 107.1 bits (266), Expect = 1.2e-22 Identity = 55/90 (61.11%), Postives = 61/90 (67.78%), Query Frame = 0
BLAST of IVF0021741 vs. ExPASy Swiss-Prot
Match: Q9FJG0 (Auxin-responsive protein SAUR20 OS=Arabidopsis thaliana OX=3702 GN=SAUR20 PE=1 SV=1) HSP 1 Score: 106.7 bits (265), Expect = 1.5e-22 Identity = 49/87 (56.32%), Postives = 65/87 (74.71%), Query Frame = 0
BLAST of IVF0021741 vs. ExPASy TrEMBL
Match: A0A5D3CK30 (Auxin-induced protein 15A-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold106G001110 PE=3 SV=1) HSP 1 Score: 204.5 bits (519), Expect = 2.0e-49 Identity = 97/97 (100.00%), Postives = 97/97 (100.00%), Query Frame = 0
BLAST of IVF0021741 vs. ExPASy TrEMBL
Match: A0A1S3BIQ5 (auxin-induced protein 15A-like OS=Cucumis melo OX=3656 GN=LOC103490320 PE=3 SV=1) HSP 1 Score: 196.8 bits (499), Expect = 4.1e-47 Identity = 94/97 (96.91%), Postives = 95/97 (97.94%), Query Frame = 0
BLAST of IVF0021741 vs. ExPASy TrEMBL
Match: A0A0A0K163 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_7G009040 PE=3 SV=1) HSP 1 Score: 179.9 bits (455), Expect = 5.2e-42 Identity = 86/97 (88.66%), Postives = 91/97 (93.81%), Query Frame = 0
BLAST of IVF0021741 vs. ExPASy TrEMBL
Match: A0A6J1C1L6 (auxin-induced protein 15A-like OS=Momordica charantia OX=3673 GN=LOC111007635 PE=3 SV=1) HSP 1 Score: 167.9 bits (424), Expect = 2.0e-38 Identity = 79/97 (81.44%), Postives = 88/97 (90.72%), Query Frame = 0
BLAST of IVF0021741 vs. ExPASy TrEMBL
Match: A0A6J1C3L5 (indole-3-acetic acid-induced protein ARG7-like OS=Momordica charantia OX=3673 GN=LOC111007632 PE=3 SV=1) HSP 1 Score: 166.4 bits (420), Expect = 5.9e-38 Identity = 76/93 (81.72%), Postives = 87/93 (93.55%), Query Frame = 0
BLAST of IVF0021741 vs. NCBI nr
Match: KAA0049701.1 (auxin-induced protein 15A-like [Cucumis melo var. makuwa] >TYK12171.1 auxin-induced protein 15A-like [Cucumis melo var. makuwa]) HSP 1 Score: 202 bits (515), Expect = 9.86e-66 Identity = 97/97 (100.00%), Postives = 97/97 (100.00%), Query Frame = 0
BLAST of IVF0021741 vs. NCBI nr
Match: XP_008448009.1 (PREDICTED: auxin-induced protein 15A-like [Cucumis melo]) HSP 1 Score: 195 bits (495), Expect = 1.11e-62 Identity = 94/97 (96.91%), Postives = 95/97 (97.94%), Query Frame = 0
BLAST of IVF0021741 vs. NCBI nr
Match: XP_031744638.1 (auxin-induced protein X10A-like [Cucumis sativus] >KGN43208.1 hypothetical protein Csa_020519 [Cucumis sativus]) HSP 1 Score: 178 bits (451), Expect = 6.31e-56 Identity = 86/97 (88.66%), Postives = 91/97 (93.81%), Query Frame = 0
BLAST of IVF0021741 vs. NCBI nr
Match: XP_022135746.1 (auxin-induced protein 15A-like [Momordica charantia]) HSP 1 Score: 166 bits (420), Expect = 3.38e-51 Identity = 79/97 (81.44%), Postives = 88/97 (90.72%), Query Frame = 0
BLAST of IVF0021741 vs. NCBI nr
Match: XP_022135742.1 (indole-3-acetic acid-induced protein ARG7-like [Momordica charantia]) HSP 1 Score: 164 bits (415), Expect = 1.96e-50 Identity = 76/93 (81.72%), Postives = 87/93 (93.55%), Query Frame = 0
BLAST of IVF0021741 vs. TAIR 10
Match: AT4G38840.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 113.2 bits (282), Expect = 1.1e-25 Identity = 50/94 (53.19%), Postives = 72/94 (76.60%), Query Frame = 0
BLAST of IVF0021741 vs. TAIR 10
Match: AT5G18080.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 109.0 bits (271), Expect = 2.2e-24 Identity = 51/91 (56.04%), Postives = 66/91 (72.53%), Query Frame = 0
BLAST of IVF0021741 vs. TAIR 10
Match: AT5G18020.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 106.7 bits (265), Expect = 1.1e-23 Identity = 49/87 (56.32%), Postives = 65/87 (74.71%), Query Frame = 0
BLAST of IVF0021741 vs. TAIR 10
Match: AT5G18050.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 105.9 bits (263), Expect = 1.8e-23 Identity = 50/91 (54.95%), Postives = 66/91 (72.53%), Query Frame = 0
BLAST of IVF0021741 vs. TAIR 10
Match: AT5G18010.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 105.5 bits (262), Expect = 2.4e-23 Identity = 50/91 (54.95%), Postives = 66/91 (72.53%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (IVF77) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|