
IVF0021408 (gene) Melon (IVF77) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGATCAAAATCATAATACCTCAAGTAGAGTGGATGAAGGGTATGAAGACTTGTTGCCGGTGATGGCACAGAAGCTCGACGTCGAGGTGTTTGTGTCTGAGCTTTGCAGCGGTTTTCGGCTGCTTGCTGATGCAACGAAAGGGCTGATTACTGCAGAGAGTTTACGGCGAAATTCAGCGCTGTTAGGAATGGAAGGGATAAATAATAATTGA ATGGATCAAAATCATAATACCTCAAGTAGAGTGGATGAAGGGTATGAAGACTTGTTGCCGGTGATGGCACAGAAGCTCGACGTCGAGGTGTTTGTGTCTGAGCTTTGCAGCGGTTTTCGGCTGCTTGCTGATGCAACGAAAGGGCTGATTACTGCAGAGAGTTTACGGCGAAATTCAGCGCTGTTAGGAATGGAAGGGATAAATAATAATTGA ATGGATCAAAATCATAATACCTCAAGTAGAGTGGATGAAGGGTATGAAGACTTGTTGCCGGTGATGGCACAGAAGCTCGACGTCGAGGTGTTTGTGTCTGAGCTTTGCAGCGGTTTTCGGCTGCTTGCTGATGCAACGAAAGGGCTGATTACTGCAGAGAGTTTACGGCGAAATTCAGCGCTGTTAGGAATGGAAGGGATAAATAATAATTGA MDQNHNTSSRVDEGYEDLLPVMAQKLDVEVFVSELCSGFRLLADATKGLITAESLRRNSALLGMEGINNN Homology
BLAST of IVF0021408 vs. ExPASy Swiss-Prot
Match: Q9ZPX9 (Calcium-binding protein KIC OS=Arabidopsis thaliana OX=3702 GN=KIC PE=1 SV=2) HSP 1 Score: 84.0 bits (206), Expect = 7.6e-16 Identity = 39/62 (62.90%), Postives = 53/62 (85.48%), Query Frame = 0
BLAST of IVF0021408 vs. ExPASy Swiss-Prot
Match: O81831 (Calcium-binding protein KRP1 OS=Arabidopsis thaliana OX=3702 GN=KRP1 PE=2 SV=1) HSP 1 Score: 54.7 bits (130), Expect = 4.9e-07 Identity = 29/59 (49.15%), Postives = 36/59 (61.02%), Query Frame = 0
BLAST of IVF0021408 vs. ExPASy Swiss-Prot
Match: Q9LSQ6 (Calcium-binding protein PBP1 OS=Arabidopsis thaliana OX=3702 GN=PBP1 PE=1 SV=1) HSP 1 Score: 53.1 bits (126), Expect = 1.4e-06 Identity = 27/57 (47.37%), Postives = 37/57 (64.91%), Query Frame = 0
BLAST of IVF0021408 vs. ExPASy TrEMBL
Match: A0A5A7TCH3 (Calcium-binding EF-hand family protein OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold122G00290 PE=4 SV=1) HSP 1 Score: 135.6 bits (340), Expect = 8.1e-29 Identity = 68/70 (97.14%), Postives = 69/70 (98.57%), Query Frame = 0
BLAST of IVF0021408 vs. ExPASy TrEMBL
Match: A0A0A0KAP2 (EF-hand domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_6G106800 PE=4 SV=1) HSP 1 Score: 128.3 bits (321), Expect = 1.3e-26 Identity = 66/71 (92.96%), Postives = 68/71 (95.77%), Query Frame = 0
BLAST of IVF0021408 vs. ExPASy TrEMBL
Match: A0A6J1KWH6 (calcium-binding protein KIC OS=Cucurbita maxima OX=3661 GN=LOC111499333 PE=4 SV=1) HSP 1 Score: 115.2 bits (287), Expect = 1.1e-22 Identity = 58/67 (86.57%), Postives = 64/67 (95.52%), Query Frame = 0
BLAST of IVF0021408 vs. ExPASy TrEMBL
Match: A0A6J1H361 (calcium-binding protein KIC OS=Cucurbita moschata OX=3662 GN=LOC111459966 PE=4 SV=1) HSP 1 Score: 114.8 bits (286), Expect = 1.5e-22 Identity = 58/67 (86.57%), Postives = 64/67 (95.52%), Query Frame = 0
BLAST of IVF0021408 vs. ExPASy TrEMBL
Match: A0A067JWV1 (EF-hand domain-containing protein OS=Jatropha curcas OX=180498 GN=JCGZ_14222 PE=4 SV=1) HSP 1 Score: 95.9 bits (237), Expect = 7.1e-17 Identity = 51/67 (76.12%), Postives = 57/67 (85.07%), Query Frame = 0
BLAST of IVF0021408 vs. NCBI nr
Match: KAA0039766.1 (Calcium-binding EF-hand family protein [Cucumis melo var. makuwa]) HSP 1 Score: 134 bits (337), Expect = 1.03e-38 Identity = 68/70 (97.14%), Postives = 69/70 (98.57%), Query Frame = 0
BLAST of IVF0021408 vs. NCBI nr
Match: XP_004140505.1 (calcium-binding protein KIC [Cucumis sativus] >KGN46528.1 hypothetical protein Csa_005589 [Cucumis sativus]) HSP 1 Score: 127 bits (318), Expect = 8.35e-36 Identity = 66/71 (92.96%), Postives = 68/71 (95.77%), Query Frame = 0
BLAST of IVF0021408 vs. NCBI nr
Match: KAG6575248.1 (Calcium-binding protein KIC, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 115 bits (288), Expect = 2.99e-31 Identity = 59/67 (88.06%), Postives = 64/67 (95.52%), Query Frame = 0
BLAST of IVF0021408 vs. NCBI nr
Match: XP_023547367.1 (calcium-binding protein KIC [Cucurbita pepo subsp. pepo]) HSP 1 Score: 115 bits (288), Expect = 2.99e-31 Identity = 59/67 (88.06%), Postives = 64/67 (95.52%), Query Frame = 0
BLAST of IVF0021408 vs. NCBI nr
Match: XP_038875235.1 (calcium-binding protein KIC [Benincasa hispida]) HSP 1 Score: 114 bits (286), Expect = 5.68e-31 Identity = 57/68 (83.82%), Postives = 63/68 (92.65%), Query Frame = 0
BLAST of IVF0021408 vs. TAIR 10
Match: AT2G46600.1 (Calcium-binding EF-hand family protein ) HSP 1 Score: 84.0 bits (206), Expect = 5.4e-17 Identity = 39/62 (62.90%), Postives = 53/62 (85.48%), Query Frame = 0
BLAST of IVF0021408 vs. TAIR 10
Match: AT4G27280.1 (Calcium-binding EF-hand family protein ) HSP 1 Score: 54.7 bits (130), Expect = 3.5e-08 Identity = 29/59 (49.15%), Postives = 36/59 (61.02%), Query Frame = 0
BLAST of IVF0021408 vs. TAIR 10
Match: AT5G54490.1 (pinoid-binding protein 1 ) HSP 1 Score: 53.1 bits (126), Expect = 1.0e-07 Identity = 27/57 (47.37%), Postives = 37/57 (64.91%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (IVF77) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|