![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
IVF0021312 (gene) Melon (IVF77) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGTGTGTTTTTTTATTACTATCAAAAGGGCTTGCTCCGGAGATTCCTGAGGATCTTTACCATTTGATTAAGAAGGCTGTCTCGATTAGAAAGCATTTGGAAAGGAATAGGAAGGACAAAGACTCCAAGTTCAGGTTGATTCTTGTTGATTCTTGA ATGTGTGTTTTTTTATTACTATCAAAAGGGCTTGCTCCGGAGATTCCTGAGGATCTTTACCATTTGATTAAGAAGGCTGTCTCGATTAGAAAGCATTTGGAAAGGAATAGGAAGGACAAAGACTCCAAGTTCAGGTTGATTCTTGTTGATTCTTGA ATGTGTGTTTTTTTATTACTATCAAAAGGGCTTGCTCCGGAGATTCCTGAGGATCTTTACCATTTGATTAAGAAGGCTGTCTCGATTAGAAAGCATTTGGAAAGGAATAGGAAGGACAAAGACTCCAAGTTCAGGTTGATTCTTGTTGATTCTTGA MCVFLLLSKGLAPEIPEDLYHLIKKAVSIRKHLERNRKDKDSKFRLILVDS Homology
BLAST of IVF0021312 vs. ExPASy Swiss-Prot
Match: P62302 (40S ribosomal protein S13 OS=Glycine max OX=3847 GN=RPS13 PE=2 SV=1) HSP 1 Score: 85.5 bits (210), Expect = 1.9e-16 Identity = 42/47 (89.36%), Postives = 45/47 (95.74%), Query Frame = 0
BLAST of IVF0021312 vs. ExPASy Swiss-Prot
Match: P62299 (40S ribosomal protein S13 OS=Brugia pahangi OX=6280 GN=RPS13 PE=2 SV=2) HSP 1 Score: 84.7 bits (208), Expect = 3.2e-16 Identity = 41/49 (83.67%), Postives = 47/49 (95.92%), Query Frame = 0
BLAST of IVF0021312 vs. ExPASy Swiss-Prot
Match: P62300 (40S ribosomal protein S13 OS=Wuchereria bancrofti OX=6293 GN=RPS13 PE=3 SV=2) HSP 1 Score: 84.7 bits (208), Expect = 3.2e-16 Identity = 41/49 (83.67%), Postives = 47/49 (95.92%), Query Frame = 0
BLAST of IVF0021312 vs. ExPASy Swiss-Prot
Match: P59223 (40S ribosomal protein S13-1 OS=Arabidopsis thaliana OX=3702 GN=RPS13A PE=2 SV=1) HSP 1 Score: 84.3 bits (207), Expect = 4.2e-16 Identity = 41/47 (87.23%), Postives = 45/47 (95.74%), Query Frame = 0
BLAST of IVF0021312 vs. ExPASy Swiss-Prot
Match: P59224 (40S ribosomal protein S13-2 OS=Arabidopsis thaliana OX=3702 GN=RPS13B PE=2 SV=1) HSP 1 Score: 84.3 bits (207), Expect = 4.2e-16 Identity = 41/47 (87.23%), Postives = 45/47 (95.74%), Query Frame = 0
BLAST of IVF0021312 vs. ExPASy TrEMBL
Match: A8UAD8 (40S ribosomal protein S13 OS=Barentsia elongata OX=478378 PE=2 SV=1) HSP 1 Score: 87.8 bits (216), Expect = 1.4e-14 Identity = 43/47 (91.49%), Postives = 46/47 (97.87%), Query Frame = 0
BLAST of IVF0021312 vs. ExPASy TrEMBL
Match: A0A5A7TK12 (40S ribosomal protein S13 OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold320G00500 PE=4 SV=1) HSP 1 Score: 87.8 bits (216), Expect = 1.4e-14 Identity = 45/53 (84.91%), Postives = 49/53 (92.45%), Query Frame = 0
BLAST of IVF0021312 vs. ExPASy TrEMBL
Match: A0A5A7U9F0 (Putative ribosomal protein S13 OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold60G001980 PE=4 SV=1) HSP 1 Score: 87.4 bits (215), Expect = 1.8e-14 Identity = 42/47 (89.36%), Postives = 44/47 (93.62%), Query Frame = 0
BLAST of IVF0021312 vs. ExPASy TrEMBL
Match: A0A0N4V0I2 (40S ribosomal protein S13 OS=Enterobius vermicularis OX=51028 GN=EVEC_LOCUS3134 PE=3 SV=1) HSP 1 Score: 87.0 bits (214), Expect = 2.4e-14 Identity = 43/49 (87.76%), Postives = 47/49 (95.92%), Query Frame = 0
BLAST of IVF0021312 vs. ExPASy TrEMBL
Match: A0A0N5AK96 (40S ribosomal protein S13 OS=Syphacia muris OX=451379 PE=3 SV=1) HSP 1 Score: 87.0 bits (214), Expect = 2.4e-14 Identity = 43/49 (87.76%), Postives = 47/49 (95.92%), Query Frame = 0
BLAST of IVF0021312 vs. NCBI nr
Match: KAA0043612.1 (40S ribosomal protein S13 [Cucumis melo var. makuwa]) HSP 1 Score: 86.3 bits (212), Expect = 3.66e-20 Identity = 45/53 (84.91%), Postives = 49/53 (92.45%), Query Frame = 0
BLAST of IVF0021312 vs. NCBI nr
Match: KAA0049888.1 (40S ribosomal protein S13-like [Cucumis melo var. makuwa]) HSP 1 Score: 85.1 bits (209), Expect = 4.64e-20 Identity = 43/47 (91.49%), Postives = 45/47 (95.74%), Query Frame = 0
BLAST of IVF0021312 vs. NCBI nr
Match: TYK07625.1 (40S ribosomal protein S13-like [Cucumis melo var. makuwa] >TYK14810.1 40S ribosomal protein S13-like [Cucumis melo var. makuwa] >TYK15131.1 40S ribosomal protein S13-like [Cucumis melo var. makuwa] >TYK22659.1 40S ribosomal protein S13-like [Cucumis melo var. makuwa]) HSP 1 Score: 85.1 bits (209), Expect = 4.64e-20 Identity = 43/47 (91.49%), Postives = 45/47 (95.74%), Query Frame = 0
BLAST of IVF0021312 vs. NCBI nr
Match: KAA0046917.1 (40S ribosomal protein S13-like [Cucumis melo var. makuwa]) HSP 1 Score: 85.1 bits (209), Expect = 4.64e-20 Identity = 43/47 (91.49%), Postives = 45/47 (95.74%), Query Frame = 0
BLAST of IVF0021312 vs. NCBI nr
Match: ONK55068.1 (uncharacterized protein A4U43_UnF7960 [Asparagus officinalis]) HSP 1 Score: 84.3 bits (207), Expect = 8.88e-20 Identity = 42/51 (82.35%), Postives = 46/51 (90.20%), Query Frame = 0
BLAST of IVF0021312 vs. TAIR 10
Match: AT3G60770.1 (Ribosomal protein S13/S15 ) HSP 1 Score: 84.3 bits (207), Expect = 3.0e-17 Identity = 41/47 (87.23%), Postives = 45/47 (95.74%), Query Frame = 0
BLAST of IVF0021312 vs. TAIR 10
Match: AT4G00100.1 (ribosomal protein S13A ) HSP 1 Score: 84.3 bits (207), Expect = 3.0e-17 Identity = 41/47 (87.23%), Postives = 45/47 (95.74%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (IVF77) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|