IVF0020090 (gene) Melon (IVF77) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGATTCAACCTCAAACCCTTTTGAATGTAGCAGATAACAGCGGAGCCCGAGAATTGATGTGTATTCGAATCATAGGGGCTAGTAATCGACGGTATGCTCATATTGGTGACGTTATTGTTCCTGTAATCAAGAAAGTCGTCCCAAATACACCTCTAGAAAGATCAGAAGTGATCATAGCTGTAATTATACGTACTTGTAAAGAACTCAAACGAGAAAATGGTATGATAATACGATATGATGACAATGCTGCGGTTGTTATCGATCAAGAAGGAAATCCAAAAGGAACTCGAATTTTTGGTGCGATTGCCTGA ATGATTCAACCTCAAACCCTTTTGAATGTAGCAGATAACAGCGGAGCCCGAGAATTGATGTGTATTCGAATCATAGGGGCTAGTAATCGACGGTATGCTCATATTGGTGACGTTATTGTTCCTGTAATCAAGAAAGTCGTCCCAAATACACCTCTAGAAAGATCAGAAGTGATCATAGCTGTAATTATACGTACTTGTAAAGAACTCAAACGAGAAAATGGTATGATAATACGATATGATGACAATGCTGCGGTTGTTATCGATCAAGAAGGAAATCCAAAAGGAACTCGAATTTTTGGTGCGATTGCCTGA ATGATTCAACCTCAAACCCTTTTGAATGTAGCAGATAACAGCGGAGCCCGAGAATTGATGTGTATTCGAATCATAGGGGCTAGTAATCGACGGTATGCTCATATTGGTGACGTTATTGTTCCTGTAATCAAGAAAGTCGTCCCAAATACACCTCTAGAAAGATCAGAAGTGATCATAGCTGTAATTATACGTACTTGTAAAGAACTCAAACGAGAAAATGGTATGATAATACGATATGATGACAATGCTGCGGTTGTTATCGATCAAGAAGGAAATCCAAAAGGAACTCGAATTTTTGGTGCGATTGCCTGA MIQPQTLLNVADNSGARELMCIRIIGASNRRYAHIGDVIVPVIKKVVPNTPLERSEVIIAVIIRTCKELKRENGMIIRYDDNAAVVIDQEGNPKGTRIFGAIA Homology
BLAST of IVF0020090 vs. ExPASy Swiss-Prot
Match: Q8WKP4 (50S ribosomal protein L14, chloroplastic OS=Cucumis sativus OX=3659 GN=rpl14 PE=2 SV=1) HSP 1 Score: 195.7 bits (496), Expect = 2.6e-49 Identity = 99/103 (96.12%), Postives = 100/103 (97.09%), Query Frame = 0
BLAST of IVF0020090 vs. ExPASy Swiss-Prot
Match: B1A971 (50S ribosomal protein L14, chloroplastic OS=Carica papaya OX=3649 GN=rpl14 PE=3 SV=1) HSP 1 Score: 188.0 bits (476), Expect = 5.5e-47 Identity = 95/102 (93.14%), Postives = 97/102 (95.10%), Query Frame = 0
BLAST of IVF0020090 vs. ExPASy Swiss-Prot
Match: Q0G9S5 (50S ribosomal protein L14, chloroplastic OS=Daucus carota OX=4039 GN=rpl14 PE=3 SV=1) HSP 1 Score: 188.0 bits (476), Expect = 5.5e-47 Identity = 94/103 (91.26%), Postives = 98/103 (95.15%), Query Frame = 0
BLAST of IVF0020090 vs. ExPASy Swiss-Prot
Match: Q7YJU2 (50S ribosomal protein L14, chloroplastic OS=Calycanthus floridus var. glaucus OX=212734 GN=rpl14 PE=3 SV=1) HSP 1 Score: 187.6 bits (475), Expect = 7.2e-47 Identity = 94/103 (91.26%), Postives = 98/103 (95.15%), Query Frame = 0
BLAST of IVF0020090 vs. ExPASy Swiss-Prot
Match: A0A372 (50S ribosomal protein L14, chloroplastic OS=Coffea arabica OX=13443 GN=rpl14 PE=3 SV=1) HSP 1 Score: 187.6 bits (475), Expect = 7.2e-47 Identity = 94/103 (91.26%), Postives = 98/103 (95.15%), Query Frame = 0
BLAST of IVF0020090 vs. ExPASy TrEMBL
Match: A0A5A7SSQ4 (Ribosomal protein L14 (Chloroplast) OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold65G002430 PE=3 SV=1) HSP 1 Score: 203.4 bits (516), Expect = 4.7e-49 Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 0
BLAST of IVF0020090 vs. ExPASy TrEMBL
Match: A0A218KG78 (50S ribosomal protein L14, chloroplastic OS=Cucumis sativus var. hardwickii OX=319220 GN=rpl14 PE=3 SV=1) HSP 1 Score: 195.7 bits (496), Expect = 9.7e-47 Identity = 99/103 (96.12%), Postives = 100/103 (97.09%), Query Frame = 0
BLAST of IVF0020090 vs. ExPASy TrEMBL
Match: A0A6H0ERW9 (50S ribosomal protein L14, chloroplastic OS=Trichosanthes kirilowii OX=3677 GN=rpl14 PE=3 SV=1) HSP 1 Score: 195.7 bits (496), Expect = 9.7e-47 Identity = 99/103 (96.12%), Postives = 100/103 (97.09%), Query Frame = 0
BLAST of IVF0020090 vs. ExPASy TrEMBL
Match: G3ETT4 (50S ribosomal protein L14, chloroplastic OS=Cucumis melo subsp. melo OX=412675 GN=rpl14 PE=3 SV=1) HSP 1 Score: 195.7 bits (496), Expect = 9.7e-47 Identity = 99/103 (96.12%), Postives = 100/103 (97.09%), Query Frame = 0
BLAST of IVF0020090 vs. ExPASy TrEMBL
Match: A0A1X9Q175 (50S ribosomal protein L14, chloroplastic OS=Cucumis sativus OX=3659 GN=rpl14 PE=3 SV=1) HSP 1 Score: 195.7 bits (496), Expect = 9.7e-47 Identity = 99/103 (96.12%), Postives = 100/103 (97.09%), Query Frame = 0
BLAST of IVF0020090 vs. NCBI nr
Match: KAA0034244.1 (ribosomal protein L14 [Cucumis melo var. makuwa]) HSP 1 Score: 201 bits (512), Expect = 4.39e-65 Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 0
BLAST of IVF0020090 vs. NCBI nr
Match: AHM88888.1 (ribosomal protein L14, partial [Lagenaria siceraria]) HSP 1 Score: 194 bits (492), Expect = 5.79e-62 Identity = 99/103 (96.12%), Postives = 100/103 (97.09%), Query Frame = 0
BLAST of IVF0020090 vs. NCBI nr
Match: AHM91247.1 (ribosomal protein L14, partial [Lagenaria siceraria]) HSP 1 Score: 194 bits (492), Expect = 5.98e-62 Identity = 99/103 (96.12%), Postives = 100/103 (97.09%), Query Frame = 0
BLAST of IVF0020090 vs. NCBI nr
Match: AHM88831.1 (ribosomal protein L14, partial [Lagenaria siceraria] >AHM91189.1 ribosomal protein L14, partial [Lagenaria siceraria]) HSP 1 Score: 194 bits (492), Expect = 6.58e-62 Identity = 99/103 (96.12%), Postives = 100/103 (97.09%), Query Frame = 0
BLAST of IVF0020090 vs. NCBI nr
Match: YP_009753040.1 (ribosomal protein L14 [Gerrardanthus macrorhizus] >QIT06112.1 ribosomal protein L14 [Gerrardanthus macrorhizus]) HSP 1 Score: 194 bits (492), Expect = 9.07e-62 Identity = 99/103 (96.12%), Postives = 100/103 (97.09%), Query Frame = 0
BLAST of IVF0020090 vs. TAIR 10
Match: ATCG00780.1 (ribosomal protein L14 ) HSP 1 Score: 185.7 bits (470), Expect = 1.9e-47 Identity = 92/102 (90.20%), Postives = 96/102 (94.12%), Query Frame = 0
BLAST of IVF0020090 vs. TAIR 10
Match: AT5G46160.1 (Ribosomal protein L14p/L23e family protein ) HSP 1 Score: 78.6 bits (192), Expect = 3.3e-15 Identity = 39/108 (36.11%), Postives = 66/108 (61.11%), Query Frame = 0
BLAST of IVF0020090 vs. TAIR 10
Match: AT5G46160.2 (Ribosomal protein L14p/L23e family protein ) HSP 1 Score: 78.6 bits (192), Expect = 3.3e-15 Identity = 39/108 (36.11%), Postives = 66/108 (61.11%), Query Frame = 0
BLAST of IVF0020090 vs. TAIR 10
Match: AT1G04480.1 (Ribosomal protein L14p/L23e family protein ) HSP 1 Score: 62.8 bits (151), Expect = 1.9e-10 Identity = 35/99 (35.35%), Postives = 60/99 (60.61%), Query Frame = 0
BLAST of IVF0020090 vs. TAIR 10
Match: AT2G33370.1 (Ribosomal protein L14p/L23e family protein ) HSP 1 Score: 62.8 bits (151), Expect = 1.9e-10 Identity = 35/99 (35.35%), Postives = 60/99 (60.61%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (IVF77) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|