
IVF0020047 (gene) Melon (IVF77) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: five_prime_UTRexonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.CTACTTGTCATCAACACTTCAATCTGCTAAGCCACGTTGGCAACAACAAACAACCATAAAAACTCTCTTTCTAATTCAATCGAAATGCTAATATCACATAAAATCTGCTCTGGGTTTTGATCTGCATGAAGTAAAAGATGAGCCAAGGCAAGTACGCTTATCCTTACTACGGTGAAGGTTACTATCAGGGACCGCCGCCGCCTCCAGTGGTAGCGCCACCACAATATGCAGCGGCTCCTCCCCAGGGACCCGGATGCCTGGAGGCTTGGTAATTCCAATCATCTAAATCCCAACCTAATGTTTATAACAACCTAATGTTTTCTCTCTATCTTATTTCTCAGTCTTGCTGCCCTGTGCTGCTGCTGTCTTGTTGACCAATGCTGCTGGTGCTGTGATCCATGGTGTCTGTTTGCCTACTAG CTACTTGTCATCAACACTTCAATCTGCTAAGCCACGTTGGCAACAACAAACAACCATAAAAACTCTCTTTCTAATTCAATCGAAATGCTAATATCACATAAAATCTGCTCTGGGTTTTGATCTGCATGAAGTAAAAGATGAGCCAAGGCAAGTACGCTTATCCTTACTACGGTGAAGGTTACTATCAGGGACCGCCGCCGCCTCCAGTGGTAGCGCCACCACAATATGCAGCGGCTCCTCCCCAGGGACCCGGATGCCTGGAGGCTTGTCTTGCTGCCCTGTGCTGCTGCTGTCTTGTTGACCAATGCTGCTGGTGCTGTGATCCATGGTGTCTGTTTGCCTACTAG ATGAGCCAAGGCAAGTACGCTTATCCTTACTACGGTGAAGGTTACTATCAGGGACCGCCGCCGCCTCCAGTGGTAGCGCCACCACAATATGCAGCGGCTCCTCCCCAGGGACCCGGATGCCTGGAGGCTTGTCTTGCTGCCCTGTGCTGCTGCTGTCTTGTTGACCAATGCTGCTGGTGCTGTGATCCATGGTGTCTGTTTGCCTACTAG MSQGKYAYPYYGEGYYQGPPPPPVVAPPQYAAAPPQGPGCLEACLAALCCCCLVDQCCWCCDPWCLFAY Homology
BLAST of IVF0020047 vs. ExPASy TrEMBL
Match: A0A0A0KGL9 (CYSTM domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_6G497280 PE=3 SV=1) HSP 1 Score: 148.7 bits (374), Expect = 9.1e-33 Identity = 68/68 (100.00%), Postives = 68/68 (100.00%), Query Frame = 0
BLAST of IVF0020047 vs. ExPASy TrEMBL
Match: A0A061DHF5 (CYSTM domain-containing protein OS=Theobroma cacao OX=3641 GN=TCM_000918 PE=3 SV=1) HSP 1 Score: 85.9 bits (211), Expect = 7.3e-14 Identity = 47/68 (69.12%), Postives = 53/68 (77.94%), Query Frame = 0
BLAST of IVF0020047 vs. ExPASy TrEMBL
Match: U5D7A4 (CYSTM domain-containing protein OS=Amborella trichopoda OX=13333 GN=AMTR_s00046p00231970 PE=3 SV=1) HSP 1 Score: 84.3 bits (207), Expect = 2.1e-13 Identity = 45/67 (67.16%), Postives = 51/67 (76.12%), Query Frame = 0
BLAST of IVF0020047 vs. ExPASy TrEMBL
Match: A0A2P5YUE9 (CYSTM domain-containing protein OS=Gossypium barbadense OX=3634 GN=ES319_A02G159600v1 PE=3 SV=1) HSP 1 Score: 84.0 bits (206), Expect = 2.8e-13 Identity = 47/68 (69.12%), Postives = 52/68 (76.47%), Query Frame = 0
BLAST of IVF0020047 vs. ExPASy TrEMBL
Match: A0A5D2RJF5 (CYSTM domain-containing protein OS=Gossypium tomentosum OX=34277 GN=ES332_A02G178200v1 PE=3 SV=1) HSP 1 Score: 84.0 bits (206), Expect = 2.8e-13 Identity = 47/68 (69.12%), Postives = 52/68 (76.47%), Query Frame = 0
BLAST of IVF0020047 vs. NCBI nr
Match: KGN48678.1 (hypothetical protein Csa_004171 [Cucumis sativus]) HSP 1 Score: 147 bits (372), Expect = 8.82e-45 Identity = 68/68 (100.00%), Postives = 68/68 (100.00%), Query Frame = 0
BLAST of IVF0020047 vs. NCBI nr
Match: KAG6594919.1 (hypothetical protein SDJN03_11472, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 121 bits (303), Expect = 3.27e-34 Identity = 59/69 (85.51%), Postives = 61/69 (88.41%), Query Frame = 0
BLAST of IVF0020047 vs. NCBI nr
Match: XP_007047698.1 (PREDICTED: cysteine-rich and transmembrane domain-containing protein A [Theobroma cacao] >EOX91855.1 Uncharacterized protein TCM_000918 [Theobroma cacao]) HSP 1 Score: 85.9 bits (211), Expect = 2.94e-20 Identity = 46/64 (71.88%), Postives = 51/64 (79.69%), Query Frame = 0
BLAST of IVF0020047 vs. NCBI nr
Match: DAD22205.1 (TPA_asm: hypothetical protein HUJ06_023669 [Nelumbo nucifera]) HSP 1 Score: 85.9 bits (211), Expect = 2.94e-20 Identity = 46/64 (71.88%), Postives = 51/64 (79.69%), Query Frame = 0
BLAST of IVF0020047 vs. NCBI nr
Match: KAB2094453.1 (hypothetical protein ES319_A02G159600v1 [Gossypium barbadense] >KAG4212145.1 hypothetical protein ERO13_A02G146200v2 [Gossypium hirsutum] >KHG06826.1 hypothetical protein F383_33724 [Gossypium arboreum] >TYH28846.1 hypothetical protein ES288_A02G176000v1 [Gossypium darwinii] >TYI40656.1 hypothetical protein ES332_A02G178200v1 [Gossypium tomentosum] >TYJ47098.1 hypothetical protein E1A91_A02G164300v1 [Gossypium mustelinum]) HSP 1 Score: 84.0 bits (206), Expect = 1.70e-19 Identity = 46/64 (71.88%), Postives = 50/64 (78.12%), Query Frame = 0
BLAST of IVF0020047 vs. TAIR 10
Match: AT4G33660.1 (unknown protein; Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI BLink). ) HSP 1 Score: 66.2 bits (160), Expect = 1.1e-11 Identity = 41/72 (56.94%), Postives = 42/72 (58.33%), Query Frame = 0
BLAST of IVF0020047 vs. TAIR 10
Match: AT5G67600.1 (unknown protein; LOCATED IN: plasma membrane; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT3G49845.1); Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI BLink). ) HSP 1 Score: 43.1 bits (100), Expect = 1.0e-04 Identity = 28/54 (51.85%), Postives = 31/54 (57.41%), Query Frame = 0
BLAST of IVF0020047 vs. TAIR 10
Match: AT2G41420.1 (proline-rich family protein ) HSP 1 Score: 40.4 bits (93), Expect = 6.7e-04 Identity = 29/58 (50.00%), Postives = 31/58 (53.45%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (IVF77) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|