IVF0017890 (gene) Melon (IVF77) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGTATATGGTGAAACGAGATGATCGTCAAGAAGCAGTGCATTTCGACAAGATCACTGCCCGTCTGAAGAAACTAAGTTATGGCCTCAACATCGATCAATGTGATCCAGTTTTGGTCTCCCAGAAAGTCTGTGTTGGAGTTTACAAGGGCATACCACTAGCCAGCTTGATGAATTGGCCGTTGAAATGGTTGCTACTATGA ATGTATATGGTGAAACGAGATGATCGTCAAGAAGCAGTGCATTTCGACAAGATCACTGCCCGTCTGAAGAAACTAAGTTATGGCCTCAACATCGATCAATGTGATCCAGTTTTGGTCTCCCAGAAAGTCTGTGTTGGAGTTTACAAGGGCATACCACTAGCCAGCTTGATGAATTGGCCGTTGAAATGGTTGCTACTATGA ATGTATATGGTGAAACGAGATGATCGTCAAGAAGCAGTGCATTTCGACAAGATCACTGCCCGTCTGAAGAAACTAAGTTATGGCCTCAACATCGATCAATGTGATCCAGTTTTGGTCTCCCAGAAAGTCTGTGTTGGAGTTTACAAGGGCATACCACTAGCCAGCTTGATGAATTGGCCGTTGAAATGGTTGCTACTATGA MYMVKRDDRQEAVHFDKITARLKKLSYGLNIDQCDPVLVSQKVCVGVYKGIPLASLMNWPLKWLLL Homology
BLAST of IVF0017890 vs. ExPASy Swiss-Prot
Match: Q9SJ20 (Ribonucleoside-diphosphate reductase large subunit OS=Arabidopsis thaliana OX=3702 GN=RNR1 PE=1 SV=1) HSP 1 Score: 94.0 bits (232), Expect = 6.9e-19 Identity = 43/56 (76.79%), Postives = 48/56 (85.71%), Query Frame = 0
BLAST of IVF0017890 vs. ExPASy Swiss-Prot
Match: Q03604 (Ribonucleoside-diphosphate reductase large subunit OS=Caenorhabditis elegans OX=6239 GN=rnr-1 PE=3 SV=1) HSP 1 Score: 74.7 bits (182), Expect = 4.3e-13 Identity = 35/57 (61.40%), Postives = 44/57 (77.19%), Query Frame = 0
BLAST of IVF0017890 vs. ExPASy Swiss-Prot
Match: Q9UW15 (Ribonucleoside-diphosphate reductase large chain OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=rnr-1 PE=1 SV=2) HSP 1 Score: 68.9 bits (167), Expect = 2.4e-11 Identity = 32/56 (57.14%), Postives = 41/56 (73.21%), Query Frame = 0
BLAST of IVF0017890 vs. ExPASy Swiss-Prot
Match: P48591 (Ribonucleoside-diphosphate reductase large subunit OS=Drosophila melanogaster OX=7227 GN=RnrL PE=1 SV=2) HSP 1 Score: 67.4 bits (163), Expect = 6.9e-11 Identity = 30/58 (51.72%), Postives = 42/58 (72.41%), Query Frame = 0
BLAST of IVF0017890 vs. ExPASy Swiss-Prot
Match: P36602 (Ribonucleoside-diphosphate reductase large chain OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cdc22 PE=1 SV=2) HSP 1 Score: 67.0 bits (162), Expect = 9.1e-11 Identity = 32/58 (55.17%), Postives = 40/58 (68.97%), Query Frame = 0
BLAST of IVF0017890 vs. ExPASy TrEMBL
Match: A0A5D3CUQ2 (Ribonucleoside-diphosphate reductase large subunit-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold513G00040 PE=4 SV=1) HSP 1 Score: 139.4 bits (350), Expect = 5.3e-30 Identity = 66/66 (100.00%), Postives = 66/66 (100.00%), Query Frame = 0
BLAST of IVF0017890 vs. ExPASy TrEMBL
Match: A0A5A7URH2 (Ribonucleoside-diphosphate reductase large subunit-like OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold697G00100 PE=4 SV=1) HSP 1 Score: 133.7 bits (335), Expect = 2.9e-28 Identity = 64/66 (96.97%), Postives = 64/66 (96.97%), Query Frame = 0
BLAST of IVF0017890 vs. ExPASy TrEMBL
Match: A0A5D3CLK7 (Ribonucleoside-diphosphate reductase OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold255G00200 PE=3 SV=1) HSP 1 Score: 99.0 bits (245), Expect = 7.9e-18 Identity = 46/56 (82.14%), Postives = 50/56 (89.29%), Query Frame = 0
BLAST of IVF0017890 vs. ExPASy TrEMBL
Match: A0A5A7SMV6 (Ribonucleoside-diphosphate reductase OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold253G00600 PE=3 SV=1) HSP 1 Score: 99.0 bits (245), Expect = 7.9e-18 Identity = 46/56 (82.14%), Postives = 50/56 (89.29%), Query Frame = 0
BLAST of IVF0017890 vs. ExPASy TrEMBL
Match: A0A7J0GUY0 (Ribonucleoside-diphosphate reductase OS=Actinidia rufa OX=165716 GN=Acr_24g0008450 PE=3 SV=1) HSP 1 Score: 99.0 bits (245), Expect = 7.9e-18 Identity = 46/56 (82.14%), Postives = 50/56 (89.29%), Query Frame = 0
BLAST of IVF0017890 vs. NCBI nr
Match: TYK14136.1 (ribonucleoside-diphosphate reductase large subunit-like [Cucumis melo var. makuwa]) HSP 1 Score: 138 bits (348), Expect = 3.30e-41 Identity = 66/66 (100.00%), Postives = 66/66 (100.00%), Query Frame = 0
BLAST of IVF0017890 vs. NCBI nr
Match: KAA0056131.1 (ribonucleoside-diphosphate reductase large subunit-like [Cucumis melo var. makuwa]) HSP 1 Score: 132 bits (333), Expect = 6.43e-39 Identity = 64/66 (96.97%), Postives = 64/66 (96.97%), Query Frame = 0
BLAST of IVF0017890 vs. NCBI nr
Match: XP_021823344.1 (ribonucleoside-diphosphate reductase large subunit-like, partial [Prunus avium]) HSP 1 Score: 95.1 bits (235), Expect = 3.06e-23 Identity = 44/56 (78.57%), Postives = 49/56 (87.50%), Query Frame = 0
BLAST of IVF0017890 vs. NCBI nr
Match: RLM60370.1 (ribonucleoside-diphosphate reductase large subunit [Panicum miliaceum]) HSP 1 Score: 93.6 bits (231), Expect = 3.77e-23 Identity = 42/51 (82.35%), Postives = 48/51 (94.12%), Query Frame = 0
BLAST of IVF0017890 vs. NCBI nr
Match: KAG5609091.1 (hypothetical protein H5410_020372 [Solanum commersonii]) HSP 1 Score: 95.9 bits (237), Expect = 4.07e-23 Identity = 45/56 (80.36%), Postives = 49/56 (87.50%), Query Frame = 0
BLAST of IVF0017890 vs. TAIR 10
Match: AT2G21790.1 (ribonucleotide reductase 1 ) HSP 1 Score: 94.0 bits (232), Expect = 4.9e-20 Identity = 43/56 (76.79%), Postives = 48/56 (85.71%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (IVF77) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|