![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
IVF0017096 (gene) Melon (IVF77) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGACTCTGTCTCTGCCGAGCCTTCTAAGTGGCTTCATCCTCCATTCTCCGCTGTCCGAACCTTCGATGGTAAAATCTTCGCCCATGGTTCTCAAGATGACAAGTCTATCGCCATCCAATATCTTGAAGCCATTCGGAATCTCAGAAACCAGGATTTCATCCCTGTCCGTACGGTTCATATATCGTATGTACCGAATGAGGAGATTGGCGGTTTCGATGGAGCTGCGAAGTCCGTTCAGTCAAAGGAGTTCAAGGAGTTGAATGTAGGGTTTATGATGGATGAAGGACAAGCTTCACCGGGAGATGAGTTTAGGGTTGGATACTGTTAG ATGGACTCTGTCTCTGCCGAGCCTTCTAAGTGGCTTCATCCTCCATTCTCCGCTGTCCGAACCTTCGATGGTAAAATCTTCGCCCATGGTTCTCAAGATGACAAGTCTATCGCCATCCAATATCTTGAAGCCATTCGGAATCTCAGAAACCAGGATTTCATCCCTGTCCGTACGGTTCATATATCGTATGTACCGAATGAGGAGATTGGCGGTTTCGATGGAGCTGCGAAGTCCGTTCAGTCAAAGGAGTTCAAGGAGTTGAATGTAGGGTTTATGATGGATGAAGGACAAGCTTCACCGGGAGATGAGTTTAGGGTTGGATACTGTTAG ATGGACTCTGTCTCTGCCGAGCCTTCTAAGTGGCTTCATCCTCCATTCTCCGCTGTCCGAACCTTCGATGGTAAAATCTTCGCCCATGGTTCTCAAGATGACAAGTCTATCGCCATCCAATATCTTGAAGCCATTCGGAATCTCAGAAACCAGGATTTCATCCCTGTCCGTACGGTTCATATATCGTATGTACCGAATGAGGAGATTGGCGGTTTCGATGGAGCTGCGAAGTCCGTTCAGTCAAAGGAGTTCAAGGAGTTGAATGTAGGGTTTATGATGGATGAAGGACAAGCTTCACCGGGAGATGAGTTTAGGGTTGGATACTGTTAG MDSVSAEPSKWLHPPFSAVRTFDGKIFAHGSQDDKSIAIQYLEAIRNLRNQDFIPVRTVHISYVPNEEIGGFDGAAKSVQSKEFKELNVGFMMDEGQASPGDEFRVGYC Homology
BLAST of IVF0017096 vs. ExPASy Swiss-Prot
Match: Q99JW2 (Aminoacylase-1 OS=Mus musculus OX=10090 GN=Acy1 PE=1 SV=1) HSP 1 Score: 103.2 bits (256), Expect = 1.9e-21 Identity = 49/107 (45.79%), Postives = 68/107 (63.55%), Query Frame = 0
BLAST of IVF0017096 vs. ExPASy Swiss-Prot
Match: Q6AYS7 (Aminoacylase-1A OS=Rattus norvegicus OX=10116 GN=Acy1a PE=1 SV=1) HSP 1 Score: 102.1 bits (253), Expect = 4.2e-21 Identity = 48/107 (44.86%), Postives = 68/107 (63.55%), Query Frame = 0
BLAST of IVF0017096 vs. ExPASy Swiss-Prot
Match: Q5RFB0 (Aminoacylase-1 OS=Pongo abelii OX=9601 GN=ACY1 PE=2 SV=2) HSP 1 Score: 100.1 bits (248), Expect = 1.6e-20 Identity = 49/107 (45.79%), Postives = 65/107 (60.75%), Query Frame = 0
BLAST of IVF0017096 vs. ExPASy Swiss-Prot
Match: Q03154 (Aminoacylase-1 OS=Homo sapiens OX=9606 GN=ACY1 PE=1 SV=1) HSP 1 Score: 99.8 bits (247), Expect = 2.1e-20 Identity = 48/107 (44.86%), Postives = 65/107 (60.75%), Query Frame = 0
BLAST of IVF0017096 vs. ExPASy Swiss-Prot
Match: P37111 (Aminoacylase-1 OS=Sus scrofa OX=9823 GN=ACY1 PE=1 SV=2) HSP 1 Score: 99.0 bits (245), Expect = 3.5e-20 Identity = 47/107 (43.93%), Postives = 64/107 (59.81%), Query Frame = 0
BLAST of IVF0017096 vs. ExPASy TrEMBL
Match: A0A5D3C5S0 (TBC1 domain family member 2A OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold606G001370 PE=4 SV=1) HSP 1 Score: 208.8 bits (530), Expect = 1.2e-50 Identity = 100/103 (97.09%), Postives = 101/103 (98.06%), Query Frame = 0
BLAST of IVF0017096 vs. ExPASy TrEMBL
Match: A0A5D3BIQ8 (Aminoacylase-1 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold350G001910 PE=4 SV=1) HSP 1 Score: 200.7 bits (509), Expect = 3.2e-48 Identity = 97/108 (89.81%), Postives = 100/108 (92.59%), Query Frame = 0
BLAST of IVF0017096 vs. ExPASy TrEMBL
Match: A0A0A0LRI1 (M20_dimer domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_1G005600 PE=4 SV=1) HSP 1 Score: 200.7 bits (509), Expect = 3.2e-48 Identity = 96/108 (88.89%), Postives = 101/108 (93.52%), Query Frame = 0
BLAST of IVF0017096 vs. ExPASy TrEMBL
Match: A0A5A7URV3 (Aminoacylase-1 OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold274G001820 PE=4 SV=1) HSP 1 Score: 199.9 bits (507), Expect = 5.5e-48 Identity = 96/108 (88.89%), Postives = 100/108 (92.59%), Query Frame = 0
BLAST of IVF0017096 vs. ExPASy TrEMBL
Match: A0A6J1CK37 (aminoacylase-1 OS=Momordica charantia OX=3673 GN=LOC111011881 PE=4 SV=1) HSP 1 Score: 193.0 bits (489), Expect = 6.7e-46 Identity = 92/108 (85.19%), Postives = 100/108 (92.59%), Query Frame = 0
BLAST of IVF0017096 vs. NCBI nr
Match: KAA0058504.1 (TBC1 domain family member 2A [Cucumis melo var. makuwa] >TYK07241.1 TBC1 domain family member 2A [Cucumis melo var. makuwa]) HSP 1 Score: 206 bits (524), Expect = 8.83e-63 Identity = 100/103 (97.09%), Postives = 101/103 (98.06%), Query Frame = 0
BLAST of IVF0017096 vs. NCBI nr
Match: TYJ98571.1 (aminoacylase-1 [Cucumis melo var. makuwa]) HSP 1 Score: 198 bits (503), Expect = 3.07e-59 Identity = 97/108 (89.81%), Postives = 100/108 (92.59%), Query Frame = 0
BLAST of IVF0017096 vs. NCBI nr
Match: KGN63599.1 (hypothetical protein Csa_013948 [Cucumis sativus]) HSP 1 Score: 198 bits (503), Expect = 3.21e-59 Identity = 96/108 (88.89%), Postives = 101/108 (93.52%), Query Frame = 0
BLAST of IVF0017096 vs. NCBI nr
Match: KAA0057884.1 (aminoacylase-1 [Cucumis melo var. makuwa]) HSP 1 Score: 197 bits (501), Expect = 3.63e-58 Identity = 96/108 (88.89%), Postives = 100/108 (92.59%), Query Frame = 0
BLAST of IVF0017096 vs. NCBI nr
Match: XP_038879728.1 (aminoacylase-1-like [Benincasa hispida]) HSP 1 Score: 192 bits (488), Expect = 5.29e-57 Identity = 93/108 (86.11%), Postives = 101/108 (93.52%), Query Frame = 0
BLAST of IVF0017096 vs. TAIR 10
Match: AT1G44180.1 (Peptidase M20/M25/M40 family protein ) HSP 1 Score: 164.9 bits (416), Expect = 3.7e-41 Identity = 75/108 (69.44%), Postives = 88/108 (81.48%), Query Frame = 0
BLAST of IVF0017096 vs. TAIR 10
Match: AT1G44820.1 (Peptidase M20/M25/M40 family protein ) HSP 1 Score: 159.5 bits (402), Expect = 1.6e-39 Identity = 72/108 (66.67%), Postives = 87/108 (80.56%), Query Frame = 0
BLAST of IVF0017096 vs. TAIR 10
Match: AT4G38220.1 (Peptidase M20/M25/M40 family protein ) HSP 1 Score: 112.8 bits (281), Expect = 1.7e-25 Identity = 54/107 (50.47%), Postives = 71/107 (66.36%), Query Frame = 0
BLAST of IVF0017096 vs. TAIR 10
Match: AT4G38220.2 (Peptidase M20/M25/M40 family protein ) HSP 1 Score: 112.8 bits (281), Expect = 1.7e-25 Identity = 54/107 (50.47%), Postives = 71/107 (66.36%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (IVF77) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|