IVF0015929 (gene) Melon (IVF77) v1

Overview


Name	IVF0015929
Type	gene
Organism	Cucumis melo L. ssp. agrestis cv. IVF77 (Melon (IVF77) v1)
Description	Unknown protein
Location	chr01: 12787081 .. 12787257 (-)
RNA-Seq Expression	IVF0015929
Synteny	IVF0015929

Sequences

The following sequences are available for this feature:

Gene sequence (with intron)

Legend: exonCDSpolypeptide

Hold the cursor over a type above to highlight its positions in the sequence below.

ATGGCATCCCACTCCGCAGTTCCATCCAGAACAAGCACTTCAAATCAAAATCCAACGAAAACAGGTAGAAGAAGAAGAAGAAAGAAGAAGCAAGAAGAAACAAGAAGAAACAAGAAGAAGTCGGCTAGGACATTACGGGTATTACACAACTACAATAATCGGAATGGAAGGGAATAG

mRNA sequence

ATGGCATCCCACTCCGCAGTTCCATCCAGAACAAGCACTTCAAATCAAAATCCAACGAAAACAGGTAGAAGAAGAAGAAGAAAGAAGAAGCAAGAAGAAACAAGAAGAAACAAGAAGAAGTCGGCTAGGACATTACGGGTATTACACAACTACAATAATCGGAATGGAAGGGAATAG

Coding sequence (CDS)

ATGGCATCCCACTCCGCAGTTCCATCCAGAACAAGCACTTCAAATCAAAATCCAACGAAAACAGGTAGAAGAAGAAGAAGAAAGAAGAAGCAAGAAGAAACAAGAAGAAACAAGAAGAAGTCGGCTAGGACATTACGGGTATTACACAACTACAATAATCGGAATGGAAGGGAATAG

Protein sequence

MASHSAVPSRTSTSNQNPTKTGRRRRRKKKQEETRRNKKKSARTLRVLHNYNNRNGRE

Homology

The following BLAST results are available for this feature:

BLAST of IVF0015929 vs.


Match Name	E-value	Identity	Description

BLAST of IVF0015929 vs.


Match Name	E-value	Identity	Description

BLAST of IVF0015929 vs.


Match Name	E-value	Identity	Description

BLAST of IVF0015929 vs.


Match Name	E-value	Identity	Description

InterPro

Analysis Name: InterPro Annotations of Melon (IVF77) v1
Date Performed: 2021-10-25


IPR Term	IPR Description	Source	Source Term	Source Description	Alignment
None	No IPR available	MOBIDB_LITE	mobidb-lite	disorder_prediction	coord: 1..19
None	No IPR available	MOBIDB_LITE	mobidb-lite	disorder_prediction	coord: 1..58
None	No IPR available	MOBIDB_LITE	mobidb-lite	disorder_prediction	coord: 20..45

Relationships

The following mRNA feature(s) are a part of this gene:


Feature Name	Unique Name	Type
IVF0015929.2	IVF0015929.2	mRNA