![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
IVF0015472 (gene) Melon (IVF77) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGAATCCAATTCGAGGGATCGACTTGAAAGGGATTGCTAAGAAGATGAATGGTGCATCCGGTGCTGAAGTTAAGGTCAGTTAGATTTTTACACGAAACATTCCTGTTTTTCTACTTCAGGTGAACAAACTTTAATGTCAATCTTGTTTCATCTTTTCAGACTCTTTGCACAGAAGTTGGAATGGCTGCTCTAAGAGAGAGAAGGGTTCATGTGACACAAGAAGATTTCGAGATGGCAATTGCAAAGGTTATGAAGAAAGACAAATAA ATGAATCCAATTCGAGGGATCGACTTGAAAGGGATTGCTAAGAAGATGAATGGTGCATCCGGTGCTGAAGTTAAGACTCTTTGCACAGAAGTTGGAATGGCTGCTCTAAGAGAGAGAAGGGTTCATGTGACACAAGAAGATTTCGAGATGGCAATTGCAAAGGTTATGAAGAAAGACAAATAA ATGAATCCAATTCGAGGGATCGACTTGAAAGGGATTGCTAAGAAGATGAATGGTGCATCCGGTGCTGAAGTTAAGACTCTTTGCACAGAAGTTGGAATGGCTGCTCTAAGAGAGAGAAGGGTTCATGTGACACAAGAAGATTTCGAGATGGCAATTGCAAAGGTTATGAAGAAAGACAAATAA MNPIRGIDLKGIAKKMNGASGAEVKTLCTEVGMAALRERRVHVTQEDFEMAIAKVMKKDK Homology
BLAST of IVF0015472 vs. ExPASy Swiss-Prot
Match: Q9C5U3 (26S proteasome regulatory subunit 8 homolog A OS=Arabidopsis thaliana OX=3702 GN=RPT6A PE=1 SV=1) HSP 1 Score: 98.6 bits (244), Expect = 2.6e-20 Identity = 49/59 (83.05%), Postives = 54/59 (91.53%), Query Frame = 0
BLAST of IVF0015472 vs. ExPASy Swiss-Prot
Match: Q94BQ2 (26S proteasome regulatory subunit 8 homolog B OS=Arabidopsis thaliana OX=3702 GN=RPT6B PE=1 SV=1) HSP 1 Score: 98.6 bits (244), Expect = 2.6e-20 Identity = 49/59 (83.05%), Postives = 54/59 (91.53%), Query Frame = 0
BLAST of IVF0015472 vs. ExPASy Swiss-Prot
Match: P34124 (26S proteasome regulatory subunit 8 OS=Dictyostelium discoideum OX=44689 GN=psmC5 PE=1 SV=2) HSP 1 Score: 91.3 bits (225), Expect = 4.1e-18 Identity = 45/59 (76.27%), Postives = 52/59 (88.14%), Query Frame = 0
BLAST of IVF0015472 vs. ExPASy Swiss-Prot
Match: P41836 (26S proteasome regulatory subunit 8 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=let1 PE=3 SV=1) HSP 1 Score: 91.3 bits (225), Expect = 4.1e-18 Identity = 45/58 (77.59%), Postives = 51/58 (87.93%), Query Frame = 0
BLAST of IVF0015472 vs. ExPASy Swiss-Prot
Match: P62194 (26S proteasome regulatory subunit 8 OS=Bos taurus OX=9913 GN=PSMC5 PE=2 SV=1) HSP 1 Score: 87.8 bits (216), Expect = 4.5e-17 Identity = 45/59 (76.27%), Postives = 51/59 (86.44%), Query Frame = 0
BLAST of IVF0015472 vs. ExPASy TrEMBL
Match: A0A5D3CAU9 (26S protease regulatory subunit 8-like protein B-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold202G002090 PE=4 SV=1) HSP 1 Score: 109.4 bits (272), Expect = 5.3e-21 Identity = 55/55 (100.00%), Postives = 55/55 (100.00%), Query Frame = 0
BLAST of IVF0015472 vs. ExPASy TrEMBL
Match: A0A5A7UBM5 (Thioredoxin F-type OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold71G00080 PE=4 SV=1) HSP 1 Score: 101.7 bits (252), Expect = 1.1e-18 Identity = 50/55 (90.91%), Postives = 53/55 (96.36%), Query Frame = 0
BLAST of IVF0015472 vs. ExPASy TrEMBL
Match: A0A5A7UDC9 (Thioredoxin F-type OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold55G002070 PE=4 SV=1) HSP 1 Score: 99.8 bits (247), Expect = 4.2e-18 Identity = 49/54 (90.74%), Postives = 52/54 (96.30%), Query Frame = 0
BLAST of IVF0015472 vs. ExPASy TrEMBL
Match: A0A2Z7D8Y5 (AAA domain-containing protein OS=Dorcoceras hygrometricum OX=472368 GN=F511_06097 PE=3 SV=1) HSP 1 Score: 99.0 bits (245), Expect = 7.2e-18 Identity = 49/59 (83.05%), Postives = 54/59 (91.53%), Query Frame = 0
BLAST of IVF0015472 vs. ExPASy TrEMBL
Match: A0A2Z7BDG2 (AAA domain-containing protein OS=Dorcoceras hygrometricum OX=472368 GN=F511_29856 PE=3 SV=1) HSP 1 Score: 99.0 bits (245), Expect = 7.2e-18 Identity = 49/59 (83.05%), Postives = 54/59 (91.53%), Query Frame = 0
BLAST of IVF0015472 vs. NCBI nr
Match: KAA0025188.1 (26S protease regulatory subunit 8-like protein B-like [Cucumis melo var. makuwa] >TYK07476.1 26S protease regulatory subunit 8-like protein B-like [Cucumis melo var. makuwa]) HSP 1 Score: 109 bits (272), Expect = 6.71e-29 Identity = 55/55 (100.00%), Postives = 55/55 (100.00%), Query Frame = 0
BLAST of IVF0015472 vs. NCBI nr
Match: KAA0051596.1 (thioredoxin F-type [Cucumis melo var. makuwa] >TYK30543.1 thioredoxin F-type [Cucumis melo var. makuwa]) HSP 1 Score: 101 bits (252), Expect = 6.46e-25 Identity = 50/55 (90.91%), Postives = 53/55 (96.36%), Query Frame = 0
BLAST of IVF0015472 vs. NCBI nr
Match: KAB2046937.1 (hypothetical protein ES319_A13G011500v1 [Gossypium barbadense] >KAB2094464.1 hypothetical protein ES319_A02G160400v1 [Gossypium barbadense] >KAG4211493.1 hypothetical protein ERO13_A02G109502v2 [Gossypium hirsutum] >TYH38631.1 hypothetical protein ES332_D12G122900v1 [Gossypium tomentosum] >TYJ50053.1 hypothetical protein E1A91_A01G179300v1 [Gossypium mustelinum]) HSP 1 Score: 96.3 bits (238), Expect = 1.81e-24 Identity = 48/59 (81.36%), Postives = 54/59 (91.53%), Query Frame = 0
BLAST of IVF0015472 vs. NCBI nr
Match: TYH63822.1 (hypothetical protein ES332_D07G221800v1 [Gossypium tomentosum]) HSP 1 Score: 96.3 bits (238), Expect = 2.07e-24 Identity = 48/59 (81.36%), Postives = 54/59 (91.53%), Query Frame = 0
BLAST of IVF0015472 vs. NCBI nr
Match: KAG4115431.1 (hypothetical protein ERO13_D12G103900v2, partial [Gossypium hirsutum]) HSP 1 Score: 96.7 bits (239), Expect = 2.47e-24 Identity = 48/59 (81.36%), Postives = 54/59 (91.53%), Query Frame = 0
BLAST of IVF0015472 vs. TAIR 10
Match: AT5G19990.1 (regulatory particle triple-A ATPase 6A ) HSP 1 Score: 98.6 bits (244), Expect = 1.8e-21 Identity = 49/59 (83.05%), Postives = 54/59 (91.53%), Query Frame = 0
BLAST of IVF0015472 vs. TAIR 10
Match: AT5G20000.1 (AAA-type ATPase family protein ) HSP 1 Score: 98.6 bits (244), Expect = 1.8e-21 Identity = 49/59 (83.05%), Postives = 54/59 (91.53%), Query Frame = 0
BLAST of IVF0015472 vs. TAIR 10
Match: AT4G29040.1 (regulatory particle AAA-ATPase 2A ) HSP 1 Score: 49.3 bits (116), Expect = 1.3e-06 Identity = 25/54 (46.30%), Postives = 35/54 (64.81%), Query Frame = 0
BLAST of IVF0015472 vs. TAIR 10
Match: AT2G20140.1 (AAA-type ATPase family protein ) HSP 1 Score: 48.9 bits (115), Expect = 1.6e-06 Identity = 25/54 (46.30%), Postives = 35/54 (64.81%), Query Frame = 0
BLAST of IVF0015472 vs. TAIR 10
Match: AT1G53750.1 (regulatory particle triple-A 1A ) HSP 1 Score: 47.4 bits (111), Expect = 4.8e-06 Identity = 24/57 (42.11%), Postives = 39/57 (68.42%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (IVF77) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|