IVF0014917 (gene) Melon (IVF77) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGTATTTTGATTTTATCATTCCAAGTTCCATCATTCCAAATAATGTTGCATTTAACCATTTAACAATTTCCCTTGACAATAGAAAGAAGAAGGCAGTTCATAAGACCACCACAACTGATGACAAAAGGCTCCAGAGTACCTTAAAGAGAACTGGGGTGAATGCTATTCCTGCTATTGAGGAGGTCAACATTTTCAAGGATGATGTGGTTATCCAATTCAACAACCCAGAGGGAAAATTTTCTTAG ATGTATTTTGATTTTATCATTCCAAGTTCCATCATTCCAAATAATGTTGCATTTAACCATTTAACAATTTCCCTTGACAATAGAAAGAAGAAGGCAGTTCATAAGACCACCACAACTGATGACAAAAGGCTCCAGAGTACCTTAAAGAGAACTGGGGTGAATGCTATTCCTGCTATTGAGGAGGTCAACATTTTCAAGGATGATGTGGTTATCCAATTCAACAACCCAGAGGGAAAATTTTCTTAG ATGTATTTTGATTTTATCATTCCAAGTTCCATCATTCCAAATAATGTTGCATTTAACCATTTAACAATTTCCCTTGACAATAGAAAGAAGAAGGCAGTTCATAAGACCACCACAACTGATGACAAAAGGCTCCAGAGTACCTTAAAGAGAACTGGGGTGAATGCTATTCCTGCTATTGAGGAGGTCAACATTTTCAAGGATGATGTGGTTATCCAATTCAACAACCCAGAGGGAAAATTTTCTTAG MYFDFIIPSSIIPNNVAFNHLTISLDNRKKKAVHKTTTTDDKRLQSTLKRTGVNAIPAIEEVNIFKDDVVIQFNNPEGKFS Homology
BLAST of IVF0014917 vs. ExPASy Swiss-Prot
Match: Q9CAT7 (Nascent polypeptide-associated complex subunit beta OS=Arabidopsis thaliana OX=3702 GN=At1g73230 PE=2 SV=1) HSP 1 Score: 92.0 bits (227), Expect = 3.2e-18 Identity = 46/50 (92.00%), Postives = 48/50 (96.00%), Query Frame = 0
BLAST of IVF0014917 vs. ExPASy Swiss-Prot
Match: Q9SMW7 (Basic transcription factor 3 OS=Arabidopsis thaliana OX=3702 GN=BTF3 PE=1 SV=1) HSP 1 Score: 89.7 bits (221), Expect = 1.6e-17 Identity = 45/50 (90.00%), Postives = 47/50 (94.00%), Query Frame = 0
BLAST of IVF0014917 vs. ExPASy Swiss-Prot
Match: Q2KIY7 (Transcription factor BTF3 homolog 4 OS=Bos taurus OX=9913 GN=BTF3L4 PE=2 SV=1) HSP 1 Score: 65.1 bits (157), Expect = 4.2e-10 Identity = 33/51 (64.71%), Postives = 39/51 (76.47%), Query Frame = 0
BLAST of IVF0014917 vs. ExPASy Swiss-Prot
Match: Q5ZJG3 (Transcription factor BTF3 homolog 4 OS=Gallus gallus OX=9031 GN=BTF3L4 PE=2 SV=1) HSP 1 Score: 65.1 bits (157), Expect = 4.2e-10 Identity = 33/51 (64.71%), Postives = 39/51 (76.47%), Query Frame = 0
BLAST of IVF0014917 vs. ExPASy Swiss-Prot
Match: Q96K17 (Transcription factor BTF3 homolog 4 OS=Homo sapiens OX=9606 GN=BTF3L4 PE=1 SV=1) HSP 1 Score: 65.1 bits (157), Expect = 4.2e-10 Identity = 33/51 (64.71%), Postives = 39/51 (76.47%), Query Frame = 0
BLAST of IVF0014917 vs. ExPASy TrEMBL
Match: A0A7J0DAV5 (Nascent polypeptide-associated complex subunit beta OS=Actinidia rufa OX=165716 GN=Acr_00g0010550 PE=3 SV=1) HSP 1 Score: 100.1 bits (248), Expect = 4.4e-18 Identity = 51/60 (85.00%), Postives = 55/60 (91.67%), Query Frame = 0
BLAST of IVF0014917 vs. ExPASy TrEMBL
Match: A0A067EX46 (Nascent polypeptide-associated complex subunit beta OS=Citrus sinensis OX=2711 GN=CISIN_1g031135mg PE=3 SV=1) HSP 1 Score: 99.4 bits (246), Expect = 7.5e-18 Identity = 50/57 (87.72%), Postives = 55/57 (96.49%), Query Frame = 0
BLAST of IVF0014917 vs. ExPASy TrEMBL
Match: A0A5B6WBT8 (Nascent polypeptide-associated complex subunit beta OS=Gossypium australe OX=47621 GN=btf3l4 PE=3 SV=1) HSP 1 Score: 99.0 bits (245), Expect = 9.7e-18 Identity = 49/54 (90.74%), Postives = 52/54 (96.30%), Query Frame = 0
BLAST of IVF0014917 vs. ExPASy TrEMBL
Match: A0A1U8LKG0 (Nascent polypeptide-associated complex subunit beta OS=Gossypium hirsutum OX=3635 GN=LOC107928335 PE=3 SV=1) HSP 1 Score: 97.1 bits (240), Expect = 3.7e-17 Identity = 48/53 (90.57%), Postives = 51/53 (96.23%), Query Frame = 0
BLAST of IVF0014917 vs. ExPASy TrEMBL
Match: A0A6A4L083 (Nascent polypeptide-associated complex subunit beta (Fragment) OS=Rhododendron williamsianum OX=262921 GN=C3L33_16900 PE=3 SV=1) HSP 1 Score: 96.7 bits (239), Expect = 4.8e-17 Identity = 49/60 (81.67%), Postives = 54/60 (90.00%), Query Frame = 0
BLAST of IVF0014917 vs. NCBI nr
Match: GFS30166.1 (basic transcription factor 3 [Actinidia rufa]) HSP 1 Score: 99.4 bits (246), Expect = 4.69e-24 Identity = 51/60 (85.00%), Postives = 55/60 (91.67%), Query Frame = 0
BLAST of IVF0014917 vs. NCBI nr
Match: KDO59689.1 (hypothetical protein CISIN_1g031135mg [Citrus sinensis]) HSP 1 Score: 98.6 bits (244), Expect = 5.33e-24 Identity = 51/61 (83.61%), Postives = 57/61 (93.44%), Query Frame = 0
BLAST of IVF0014917 vs. NCBI nr
Match: KAA3479189.1 (basic transcription factor 3-like isoform X1 [Gossypium australe]) HSP 1 Score: 97.8 bits (242), Expect = 1.70e-23 Identity = 49/54 (90.74%), Postives = 52/54 (96.30%), Query Frame = 0
BLAST of IVF0014917 vs. NCBI nr
Match: GFZ05932.1 (basic transcription factor 3 [Actinidia rufa]) HSP 1 Score: 95.5 bits (236), Expect = 4.08e-23 Identity = 48/51 (94.12%), Postives = 49/51 (96.08%), Query Frame = 0
BLAST of IVF0014917 vs. NCBI nr
Match: GFS30168.1 (basic transcription factor 3 [Actinidia rufa]) HSP 1 Score: 95.5 bits (236), Expect = 4.20e-23 Identity = 48/51 (94.12%), Postives = 49/51 (96.08%), Query Frame = 0
BLAST of IVF0014917 vs. TAIR 10
Match: AT1G73230.1 (Nascent polypeptide-associated complex NAC ) HSP 1 Score: 92.0 bits (227), Expect = 2.3e-19 Identity = 46/50 (92.00%), Postives = 48/50 (96.00%), Query Frame = 0
BLAST of IVF0014917 vs. TAIR 10
Match: AT1G17880.1 (basic transcription factor 3 ) HSP 1 Score: 89.7 bits (221), Expect = 1.1e-18 Identity = 45/50 (90.00%), Postives = 47/50 (94.00%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (IVF77) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|