
IVF0013811 (gene) Melon (IVF77) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGCCTTGCTTTGTTGGAGGAAAACAAAACTTCGATTGGGGTTTGCGGGGGCATTCCACCACTGGTATCTTTACTACTGAATGGATCAAATAGAAGGAAGAAGGACGCGCTCACGACGCTCTATAAGCTTTGCTTGATCAAACCAAATAACGAGCAGGCCATCACTGCTCGAGCTGTGAAGCCATTGGTGGCGCTAGTAGCGGAGCAAGGTACGAGTTTAGCAGAGAAGGCGATGGTGGTTTTGAGTAACCTGGCTGGGATTCAAGAGGGAAAGGATACGATTGTGGAAGAGGGTGGAATTGCTGCGCTTGTAG ATGAGCCTTGCTTTGTTGGAGGAAAACAAAACTTCGATTGGGGTTTGCGGGGGCATTCCACCACTGGTATCTTTACTACTGAATGGATCAAATAGAAGGAAGAAGGACGCGCTCACGACGCTCTATAAGCTTTGCTTGATCAAACCAAATAACGAGCAGGCCATCACTGCTCGAGCTGTGAAGCCATTGGTGGCGCTAGTAGCGGAGCAAGGTACGATAACCTGGCTGGGATTCAAGAGGGAAAGGATACGATTGTGGAAGAGGGTGGAATTGCTGCGCTTGTAG ATGAGCCTTGCTTTGTTGGAGGAAAACAAAACTTCGATTGGGGTTTGCGGGGGCATTCCACCACTGGTATCTTTACTACTGAATGGATCAAATAGAAGGAAGAAGGACGCGCTCACGACGCTCTATAAGCTTTGCTTGATCAAACCAAATAACGAGCAGGCCATCACTGCTCGAGCTGTGAAGCCATTGGTGGCGCTAGTAGCGGAGCAAGGTACGATAACCTGGCTGGGATTCAAGAGGGAAAGGATACGATTGTGGAAGAGGGTGGAATTGCTGCGCTTGTAG MSLALLEENKTSIGVCGGIPPLVSLLLNGSNRRKKDALTTLYKLCLIKPNNEQAITARAVKPLVALVAEQGTITWLGFKRERIRLWKRVELLRL Homology
BLAST of IVF0013811 vs. ExPASy Swiss-Prot
Match: Q9ZV31 (U-box domain-containing protein 12 OS=Arabidopsis thaliana OX=3702 GN=PUB12 PE=2 SV=1) HSP 1 Score: 68.2 bits (165), Expect = 5.8e-11 Identity = 33/68 (48.53%), Postives = 46/68 (67.65%), Query Frame = 0
BLAST of IVF0013811 vs. ExPASy Swiss-Prot
Match: Q681N2 (U-box domain-containing protein 15 OS=Arabidopsis thaliana OX=3702 GN=PUB15 PE=2 SV=2) HSP 1 Score: 67.8 bits (164), Expect = 7.6e-11 Identity = 35/69 (50.72%), Postives = 49/69 (71.01%), Query Frame = 0
BLAST of IVF0013811 vs. ExPASy Swiss-Prot
Match: Q9SNC6 (U-box domain-containing protein 13 OS=Arabidopsis thaliana OX=3702 GN=PUB13 PE=1 SV=1) HSP 1 Score: 67.4 bits (163), Expect = 9.9e-11 Identity = 33/71 (46.48%), Postives = 46/71 (64.79%), Query Frame = 0
BLAST of IVF0013811 vs. ExPASy Swiss-Prot
Match: Q8VZ40 (U-box domain-containing protein 14 OS=Arabidopsis thaliana OX=3702 GN=PUB14 PE=1 SV=1) HSP 1 Score: 62.8 bits (151), Expect = 2.4e-09 Identity = 29/70 (41.43%), Postives = 44/70 (62.86%), Query Frame = 0
BLAST of IVF0013811 vs. ExPASy Swiss-Prot
Match: Q9C9A6 (U-box domain-containing protein 10 OS=Arabidopsis thaliana OX=3702 GN=PUB10 PE=2 SV=1) HSP 1 Score: 62.4 bits (150), Expect = 3.2e-09 Identity = 33/71 (46.48%), Postives = 44/71 (61.97%), Query Frame = 0
BLAST of IVF0013811 vs. ExPASy TrEMBL
Match: A0A5D3D6A7 (Gag-protease polyprotein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold529G00240 PE=4 SV=1) HSP 1 Score: 141.7 bits (356), Expect = 1.5e-30 Identity = 72/72 (100.00%), Postives = 72/72 (100.00%), Query Frame = 0
BLAST of IVF0013811 vs. ExPASy TrEMBL
Match: A0A5D3CRG4 (U-box domain-containing protein 4 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold255G005940 PE=4 SV=1) HSP 1 Score: 127.5 bits (319), Expect = 3.0e-26 Identity = 65/72 (90.28%), Postives = 67/72 (93.06%), Query Frame = 0
BLAST of IVF0013811 vs. ExPASy TrEMBL
Match: A0A0A0KL34 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G511670 PE=4 SV=1) HSP 1 Score: 127.5 bits (319), Expect = 3.0e-26 Identity = 65/72 (90.28%), Postives = 67/72 (93.06%), Query Frame = 0
BLAST of IVF0013811 vs. ExPASy TrEMBL
Match: A0A1S3B089 (U-box domain-containing protein 4 OS=Cucumis melo OX=3656 GN=LOC103484662 PE=4 SV=1) HSP 1 Score: 127.5 bits (319), Expect = 3.0e-26 Identity = 65/72 (90.28%), Postives = 67/72 (93.06%), Query Frame = 0
BLAST of IVF0013811 vs. ExPASy TrEMBL
Match: A0A6J1KQR1 (U-box domain-containing protein 4-like OS=Cucurbita maxima OX=3661 GN=LOC111496781 PE=4 SV=1) HSP 1 Score: 125.9 bits (315), Expect = 8.6e-26 Identity = 64/72 (88.89%), Postives = 66/72 (91.67%), Query Frame = 0
BLAST of IVF0013811 vs. NCBI nr
Match: KAA0035911.1 (gag-protease polyprotein [Cucumis melo var. makuwa] >TYK19065.1 gag-protease polyprotein [Cucumis melo var. makuwa]) HSP 1 Score: 143 bits (360), Expect = 1.65e-37 Identity = 72/72 (100.00%), Postives = 72/72 (100.00%), Query Frame = 0
BLAST of IVF0013811 vs. NCBI nr
Match: XP_038881710.1 (U-box domain-containing protein 4 [Benincasa hispida]) HSP 1 Score: 129 bits (323), Expect = 6.28e-33 Identity = 65/72 (90.28%), Postives = 67/72 (93.06%), Query Frame = 0
BLAST of IVF0013811 vs. NCBI nr
Match: XP_008440076.1 (PREDICTED: U-box domain-containing protein 4 [Cucumis melo] >TYK12996.1 U-box domain-containing protein 4 [Cucumis melo var. makuwa]) HSP 1 Score: 129 bits (323), Expect = 6.28e-33 Identity = 65/72 (90.28%), Postives = 67/72 (93.06%), Query Frame = 0
BLAST of IVF0013811 vs. NCBI nr
Match: XP_004134799.1 (U-box domain-containing protein 4 [Cucumis sativus] >KGN49052.1 hypothetical protein Csa_003608 [Cucumis sativus]) HSP 1 Score: 129 bits (323), Expect = 6.28e-33 Identity = 65/72 (90.28%), Postives = 67/72 (93.06%), Query Frame = 0
BLAST of IVF0013811 vs. NCBI nr
Match: XP_023518630.1 (U-box domain-containing protein 4-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 127 bits (319), Expect = 2.37e-32 Identity = 64/72 (88.89%), Postives = 66/72 (91.67%), Query Frame = 0
BLAST of IVF0013811 vs. TAIR 10
Match: AT4G16490.1 (ARM repeat superfamily protein ) HSP 1 Score: 110.2 bits (274), Expect = 9.4e-25 Identity = 56/72 (77.78%), Postives = 62/72 (86.11%), Query Frame = 0
BLAST of IVF0013811 vs. TAIR 10
Match: AT2G28830.1 (PLANT U-BOX 12 ) HSP 1 Score: 68.2 bits (165), Expect = 4.1e-12 Identity = 33/68 (48.53%), Postives = 46/68 (67.65%), Query Frame = 0
BLAST of IVF0013811 vs. TAIR 10
Match: AT5G42340.1 (Plant U-Box 15 ) HSP 1 Score: 67.8 bits (164), Expect = 5.4e-12 Identity = 35/69 (50.72%), Postives = 49/69 (71.01%), Query Frame = 0
BLAST of IVF0013811 vs. TAIR 10
Match: AT3G46510.1 (plant U-box 13 ) HSP 1 Score: 67.4 bits (163), Expect = 7.0e-12 Identity = 33/71 (46.48%), Postives = 46/71 (64.79%), Query Frame = 0
BLAST of IVF0013811 vs. TAIR 10
Match: AT3G01400.1 (ARM repeat superfamily protein ) HSP 1 Score: 66.2 bits (160), Expect = 1.6e-11 Identity = 35/72 (48.61%), Postives = 47/72 (65.28%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (IVF77) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|